UniProt ID | MOB3B_HUMAN | |
---|---|---|
UniProt AC | Q86TA1 | |
Protein Name | MOB kinase activator 3B | |
Gene Name | MOB3B {ECO:0000312|HGNC:HGNC:23825} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 216 | |
Subcellular Localization | ||
Protein Description | May regulate the activity of kinases.. | |
Protein Sequence | MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | QVFNKDKTFRPKRKF HHHCCCCCCCCCCCC | 34.70 | - | |
20 | Acetylation | KTFRPKRKFEPGTQR CCCCCCCCCCCCCCC | 61.27 | 25953088 | |
20 | Ubiquitination | KTFRPKRKFEPGTQR CCCCCCCCCCCCCCC | 61.27 | - | |
25 | Phosphorylation | KRKFEPGTQRFELHK CCCCCCCCCCHHHHH | 27.56 | 28060719 | |
37 | Phosphorylation | LHKRAQASLNSGVDL HHHHHHHHHHCCCCE | 18.92 | 28857561 | |
77 | Phosphorylation | RINLIYGTICEFCTE HHHHHHHHHHHHHCC | 12.89 | - | |
86 | Phosphorylation | CEFCTERTCPVMSGG HHHHCCCCCCCCCCC | 18.22 | 23898821 | |
91 | Phosphorylation | ERTCPVMSGGPKYEY CCCCCCCCCCCCCEE | 40.61 | 23898821 | |
96 | Phosphorylation | VMSGGPKYEYRWQDD CCCCCCCCEEECCCC | 22.71 | 25404012 | |
98 | Phosphorylation | SGGPKYEYRWQDDLK CCCCCCEEECCCCCC | 17.67 | 25404012 | |
190 | Phosphorylation | NTCYKHFYYFVTEMN HHHHHHHHHHHHHCC | 8.84 | 25907765 | |
191 | Phosphorylation | TCYKHFYYFVTEMNL HHHHHHHHHHHHCCC | 7.22 | 25907765 | |
194 | Phosphorylation | KHFYYFVTEMNLIDR HHHHHHHHHCCCCCH | 21.44 | 25907765 | |
208 | Ubiquitination | RKELEPLKEMTSRMC HHHCHHHHHHHHHHC | 57.04 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB3B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB3B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB3B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CXCL7_HUMAN | PPBP | physical | 21900206 | |
LATS1_HUMAN | LATS1 | physical | 19739119 | |
LATS2_HUMAN | LATS2 | physical | 19739119 | |
5NTC_HUMAN | NT5C2 | physical | 19060904 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...