MOB2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MOB2_SCHPO
• UniProt AC: O74558
• Protein Name: Maintenance of ploidy protein mob2
• Gene Name: mob2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 244
• Subcellular Localization: Cytoplasm . Cytoplasm, cell cortex . Localizes to the cell periphery and to the division site during septation and cytokinesis.
• Protein Description: Required for coordinating polarized cell growth during interphase with the onset of mitosis..
• Protein Sequence: MFLLNSLSRITRGNRSKRHQNLSDASSSSGSFSKKSSTSQLVRTGSPSVEPTALYLQQPFVRTHLVKGNFSTIVSLPRFVDLDEWVALNVYELFTYLNHFYDVFATFCTVKTCPVMSAAANFDYTWLDNNRKPVHLPAPQYIEYVLAWIENRLHDQNVFPTKAGLPFPSNFLVIVKAIYKQMFRIFAHMYYAHYAEILHLSLEAHWNSFFAHFIAFGKEFQLLDKRDTAPLKDLIVVLENQGNI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	SKRHQNLSDASSSSG CCCCCCHHHCCCCCC	38.38	21712547
26	Phosphorylation	HQNLSDASSSSGSFS CCCHHHCCCCCCCCC	35.43	29996109
27	Phosphorylation	QNLSDASSSSGSFSK CCHHHCCCCCCCCCC	30.18	24763107
28	Phosphorylation	NLSDASSSSGSFSKK CHHHCCCCCCCCCCC	35.90	21712547
29	Phosphorylation	LSDASSSSGSFSKKS HHHCCCCCCCCCCCC	40.16	25720772
31	Phosphorylation	DASSSSGSFSKKSST HCCCCCCCCCCCCCC	28.44	21712547
33	Phosphorylation	SSSSGSFSKKSSTSQ CCCCCCCCCCCCCCC	40.65	21712547
36	Phosphorylation	SGSFSKKSSTSQLVR CCCCCCCCCCCCHHH	42.45	29996109
37	Phosphorylation	GSFSKKSSTSQLVRT CCCCCCCCCCCHHHC	40.74	25720772
44	Phosphorylation	STSQLVRTGSPSVEP CCCCHHHCCCCCCCC	34.23	29996109
46	Phosphorylation	SQLVRTGSPSVEPTA CCHHHCCCCCCCCCE	17.25	28889911
48	Phosphorylation	LVRTGSPSVEPTALY HHHCCCCCCCCCEEH	40.59	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MOB2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MOB2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MOB2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PROF_SCHPO	cdc3	physical	12456722
TPM_SCHPO	cdc8	physical	12456722
CDC7_SCHPO	cdc7	physical	12456722
SID2_SCHPO	sid2	physical	12456722
ORB6_SCHPO	orb6	physical	12456722
PMO25_SCHPO	pmo25	physical	16325501
ORB6_SCHPO	orb6	physical	23649273
ORB6_SCHPO	orb6	physical	23615447

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-46 AND SER-48, AND MASSSPECTROMETRY.
PubMed: 18257517