dbPTM

MIS13_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MIS13_SCHPO
UniProt AC	Q9UUB5
Protein Name	Kinetochore protein mis13
Gene Name	mis13
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	329
Subcellular Localization	Nucleus .
Protein Description	Acts as a component of the NMS (Ndc80-MIND-Spc7) super complex which has a role in kinetochore function during late meiotic prophase and throughout the mitotic cell cycle. Required for correct segregation of chromosomes and for maintaining the inner centromere structure..
Protein Sequence	MKRKPEEQEGFVFVRKGKEKAGSKRRKSSVEDDPDTSQTDGLVELPVSDTPIVKRNKELRKGKGRRSSLDQRGKRASSIGTGFEALPHADVPSHEYYRHISKDLSEPLRIKQLLLWASSKALEEQRKKYGETEEASEAAIARSIVQEVLNELLANKVSVSWYQRPPDAVIPNKPHPQNLKNAQLVDELSAKLTQLHNEEAAWRAVAANSVSSDKSILSFKKAVESIDSKQDLDKQDSPLPPDDAPELPNISKLKPKFHTLLDMLAENIHTLHSLTNAGPEVRSSYGRLAAQDFIAHRKSLLSFSKYVDTMNLLRLLSEASYKSSSNESV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
77	Phosphorylation	DQRGKRASSIGTGFE HHHCCCHHHCCCCCH	26.90	29996109
78	Phosphorylation	QRGKRASSIGTGFEA HHCCCHHHCCCCCHH	24.85	29996109
81	Phosphorylation	KRASSIGTGFEALPH CCHHHCCCCCHHCCC	36.71	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MIS13_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MIS13_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MIS13_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MIS12_SCHPO	mis12	physical	15502821
MIS14_SCHPO	mis14	genetic	15502821
GSK3_SCHPO	gsk3	genetic	15502821
SPC7_SCHPO	spc7	genetic	15502821
SPC7_SCHPO	spc7	physical	15502821
PHD1_SCHPO	hos2	genetic	17352737

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MIS13_SCHPO

Related Literatures of Post-Translational Modification