UniProt ID | MIP_HUMAN | |
---|---|---|
UniProt AC | P30301 | |
Protein Name | Lens fiber major intrinsic protein | |
Gene Name | MIP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 263 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . Cell junction, gap junction . |
|
Protein Description | Water channel. [PubMed: 24120416 Channel activity is down-regulated by CALM when cytoplasmic Ca(2+) levels are increased. May be responsible for regulating the osmolarity of the lens. Interactions between homotetramers from adjoining membranes may stabilize cell junctions in the eye lens core (By similarity Plays a role in cell-to-cell adhesion and facilitates gap junction coupling] | |
Protein Sequence | MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVGHISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | VFFGLGSSLRWAPGP HHHCCCCCCCCCCCH | 21.83 | 24719451 | |
229 | Phosphorylation | LLFPRLKSISERLSV HHHHHHHHHHHHHHH | 35.62 | 2176601 | |
231 | Phosphorylation | FPRLKSISERLSVLK HHHHHHHHHHHHHHH | 24.61 | 18081321 | |
235 | Phosphorylation | KSISERLSVLKGAKP HHHHHHHHHHHCCCC | 31.46 | 18081321 | |
245 | Phosphorylation | KGAKPDVSNGQPEVT HCCCCCCCCCCCCCC | 42.49 | - | |
246 | Deamidated asparagine | GAKPDVSNGQPEVTG CCCCCCCCCCCCCCC | 53.63 | - | |
246 | Deamidation | GAKPDVSNGQPEVTG CCCCCCCCCCCCCCC | 53.63 | 10634618 | |
259 | Deamidated asparagine | TGEPVELNTQAL--- CCCCEECCCCCC--- | 19.35 | - | |
259 | Deamidation | TGEPVELNTQAL--- CCCCEECCCCCC--- | 19.35 | 10634618 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
229 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
229 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
231 | S | Phosphorylation | Kinase | PKA-FAMILY | - | GPS |
231 | S | Phosphorylation | Kinase | PKA_GROUP | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MIP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MIP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CRYAA_HUMAN | CRYAA | physical | 18004741 | |
CRYAB_HUMAN | CRYAB | physical | 18004741 | |
CRBB2_HUMAN | CRYBB2 | physical | 18004741 | |
CRGC_HUMAN | CRYGC | physical | 18004741 |
loading...
Deamidation | |
Reference | PubMed |
"Characterization of human lens major intrinsic protein structure."; Schey K.L., Little M., Fowler J.G., Crouch R.K.; Invest. Ophthalmol. Vis. Sci. 41:175-182(2000). Cited for: PHOSPHORYLATION AT SER-235, DEAMIDATION AT ASN-246 AND ASN-259, ANDMASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Characterization of human lens major intrinsic protein structure."; Schey K.L., Little M., Fowler J.G., Crouch R.K.; Invest. Ophthalmol. Vis. Sci. 41:175-182(2000). Cited for: PHOSPHORYLATION AT SER-235, DEAMIDATION AT ASN-246 AND ASN-259, ANDMASS SPECTROMETRY. |