UniProt ID | M2K3_ARATH | |
---|---|---|
UniProt AC | O80396 | |
Protein Name | Mitogen-activated protein kinase kinase 3 | |
Gene Name | MKK3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 520 | |
Subcellular Localization | ||
Protein Description | MKK3-MPK6 module plays an important role in the jasmonate signal transduction pathway through the negative regulation of MYC2/JIN1 expression. Activates by phosphorylation the downstream MPK6, MPK7 and MPK8. MKK3-MPK7 module acts as a positive regulator of PR1 gene expression. MKK3-MPK8 module negatively regulates ROS accumulation through controlling expression of the RBOHD gene. Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses. Activator of the C group MAP kinases. Activates MPK7 in response to ABA. [PubMed: 25720833] | |
Protein Sequence | MAALEELKKKLSPLFDAEKGFSSSSSLDPNDSYLLSDGGTVNLLSRSYGVYNFNELGLQKCTSSHVDESESSETTYQCASHEMRVFGAIGSGASSVVQRAIHIPNHRILALKKINIFEREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYMNGGSLADILKVTKKIPEPVLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLLINLKGEPKITDFGISAGLENSMAMCATFVGTVTYMSPERIRNDSYSYPADIWSLGLALFECGTGEFPYIANEGPVNLMLQILDDPSPTPPKQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFITKHEKERVDLATFVQSIFDPTQRLKDLADMLTIHYYSLFDGFDDLWHHAKSLYTETSVFSFSGKHNTGSTEIFSALSDIRNTLTGDLPSEKLVHVVEKLHCKPCGSGGVIIRAVGSFIVGNQFLICGDGVQAEGLPSFKDLGFDVASRRVGRFQEQFVVESGDLIGKYFLAKQELYITNLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | TVNLLSRSYGVYNFN CEEEEECCCCCCCHH | 23572148 | ||
69 | Phosphorylation | TSSHVDESESSETTY CCCCCCCCCCCCCHH | - | ||
235 | Phosphorylation | ISAGLENSMAMCATF CCCCCCCHHHHHHHH | 17369371 | ||
241 | Phosphorylation | NSMAMCATFVGTVTY CHHHHHHHHEEEEEE | 17369371 | ||
245 | Phosphorylation | MCATFVGTVTYMSPE HHHHHEEEEEECCHH | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of M2K3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of M2K3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPK1_ARATH | MPK1 | physical | 25680457 | |
MPK2_ARATH | MPK2 | physical | 25680457 | |
MPK7_ARATH | MPK7 | physical | 25680457 | |
MYC2_ARATH | MYC2 | genetic | 25139007 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...