| UniProt ID | LMX1A_HUMAN | |
|---|---|---|
| UniProt AC | Q8TE12 | |
| Protein Name | LIM homeobox transcription factor 1-alpha | |
| Gene Name | LMX1A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 382 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. Required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae (By similarity).. | |
| Protein Sequence | MLDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLETTCFYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEGQLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAFKASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGSAGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGDCFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Phosphorylation | IDTSASFSSLLGRAV HHCHHCHHHHHCCCC | 19.99 | 24719451 | |
| 88 | Ubiquitination | YCKYDYEKLFAVKCG EEECCHHHEEEEEEC | 42.55 | - | |
| 163 | Phosphorylation | SLVSPAASDSGKSDD HHHCCCCCCCCCCCC | 34.12 | - | |
| 232 | Phosphorylation | RETLAAETGLSVRVV HHHHHHHHCCCEEEE | 38.40 | 17322306 | |
| 235 | Phosphorylation | LAAETGLSVRVVQVW HHHHHCCCEEEEEHH | 14.82 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LMX1A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LMX1A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LMX1A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TFE2_HUMAN | TCF3 | physical | 9199284 | |
| LMX1A_HUMAN | LMX1A | physical | 9199284 | |
| LMX1A_HUMAN | LMX1A | physical | 9452425 | |
| LHX3_HUMAN | LHX3 | physical | 9452425 | |
| GRB2_HUMAN | GRB2 | physical | 25814554 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
