| UniProt ID | KLRD1_HUMAN | |
|---|---|---|
| UniProt AC | Q13241 | |
| Protein Name | Natural killer cells antigen CD94 | |
| Gene Name | KLRD1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 179 | |
| Subcellular Localization |
Membrane Single-pass type II membrane protein. |
|
| Protein Description | Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.. | |
| Protein Sequence | MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Phosphorylation | TTLWRLISGTLGIIC HHHHHHHHHHHHHHH | 30.25 | - | |
| 15 | Phosphorylation | LWRLISGTLGIICLS HHHHHHHHHHHHHHH | 18.28 | - | |
| 34 | Phosphorylation | LGILLKNSFTKLSIE HHHHHHCCCEEEEEE | 32.48 | 24719451 | |
| 73 | Phosphorylation | VGYRCNCYFISSEQK EEEEEEEEEEECCCC | 7.03 | - | |
| 83 | N-linked_Glycosylation | SSEQKTWNESRHLCA ECCCCCCHHHHHCHH | 42.47 | UniProtKB CARBOHYD | |
| 132 | N-linked_Glycosylation | HTAWLWENGSALSQY HEEEECCCCCHHHHH | 37.83 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLRD1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLRD1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLRD1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NKG2A_HUMAN | KLRC1 | physical | 8943374 | |
| NKG2C_HUMAN | KLRC2 | physical | 8943374 | |
| NKG2E_HUMAN | KLRC3 | physical | 8943374 | |
| HLAE_HUMAN | HLA-E | physical | 9886400 | |
| NKG2A_HUMAN | KLRC1 | physical | 9034158 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
