dbPTM

JDP2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	JDP2_HUMAN
UniProt AC	Q8WYK2
Protein Name	Jun dimerization protein 2
Gene Name	JDP2
Organism	Homo sapiens (Human).
Sequence Length	163
Subcellular Localization	Nucleus .
Protein Description	Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin..
Protein Sequence	MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPESEGNPLLEQLEKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
65	Sumoylation	GKRPQPVKSELDEEE CCCCCCCCCCCCHHH	44.91	-
65	Sumoylation	GKRPQPVKSELDEEE CCCCCCCCCCCCHHH	44.91	28112733
138	Phosphorylation	MLNRHRPTCIVRTDS HHHCCCCCEEEECCC	18.15	22817900
143	Phosphorylation	RPTCIVRTDSVKTPE CCCEEEECCCCCCCC	23.02	21712546
145	Phosphorylation	TCIVRTDSVKTPESE CEEEECCCCCCCCCC	25.54	30266825
148	Phosphorylation	VRTDSVKTPESEGNP EECCCCCCCCCCCCH	30.08	30266825
151	Phosphorylation	DSVKTPESEGNPLLE CCCCCCCCCCCHHHH	52.59	30266825
156	Phosphorylation	PESEGNPLLEQLEKK CCCCCCHHHHHHHCC	10.76	24719451
159	Phosphorylation	EGNPLLEQLEKK--- CCCHHHHHHHCC---	55.69	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
148	T	Phosphorylation	Kinase	MAPK8	P45983	Uniprot
148	T	Phosphorylation	Kinase	MAPK9	P45984	GPS
148	T	Phosphorylation	Kinase	MAPK14	Q16539	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
148	T	Oxidation	18307971
Phosphorylation of Thr-148 by MAPK8 in response to different stress conditions such as, UV irradiation, oxidatives stress and anisomycin treatments.
148	T	Phosphorylation	18307971
Phosphorylation of Thr-148 by MAPK8 in response to different stress conditions such as, UV irradiation, oxidatives stress and anisomycin treatments.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of JDP2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
I2BP1_HUMAN	IRF2BP1	physical	18671972
ATF7_HUMAN	ATF7	physical	18671972
JUND_HUMAN	JUND	physical	18671972
JUN_HUMAN	JUN	physical	18671972
ATF2_HUMAN	ATF2	physical	18307971
JDP2_HUMAN	JDP2	physical	18396163
ATF2_HUMAN	ATF2	physical	18396163
PRGR_HUMAN	PGR	physical	12101239
HDAC6_HUMAN	HDAC6	physical	22989952

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
DB00852	Pseudoephedrine

Regulatory Network of JDP2_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphorylation of two eukaryotic transcription factors, Jundimerization protein 2 and activation transcription factor 2, inEscherichia coli by Jun N-terminal kinase 1."; Murata T., Shinozuka Y., Obata Y., Yokoyama K.K.; Anal. Biochem. 376:115-121(2008). Cited for: MASS SPECTROMETRY, AND PHOSPHORYLATION AT THR-148 BY MAPK8.	18307971 [Abstract]