IPKG_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IPKG_HUMAN
• UniProt AC: Q9Y2B9
• Protein Name: cAMP-dependent protein kinase inhibitor gamma
• Gene Name: PKIG
• Organism: Homo sapiens (Human).
• Sequence Length: 76
• Protein Description: Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains..
• Protein Sequence: MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MMEVESSYSDFIS --CCCCCCCHHHCCC	39.49	27251275
7	Phosphorylation	-MMEVESSYSDFISC -CCCCCCCHHHCCCC	18.36	27251275
8	Phosphorylation	MMEVESSYSDFISCD CCCCCCCHHHCCCCC	22.87	27642862
69	Phosphorylation	EAGNQPQSSDGTTSS CCCCCCCCCCCCCCC	36.76	-
73	Phosphorylation	QPQSSDGTTSS---- CCCCCCCCCCC----	28.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IPKG_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IPKG_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IPKG_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAB25_HUMAN	RAB25	physical	17353931
KPTN_HUMAN	KPTN	physical	17353931
RFA3_HUMAN	RPA3	physical	17353931
KAPCA_HUMAN	PRKACA	physical	17353931
KAPCB_HUMAN	PRKACB	physical	28514442
TYSY_HUMAN	TYMS	physical	28514442
TPM2_HUMAN	TPM2	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.