UniProt ID | INSL5_DROME | |
---|---|---|
UniProt AC | Q7KUD5 | |
Protein Name | Probable insulin-like peptide 5 | |
Gene Name | Ilp5 {ECO:0000312|FlyBase:FBgn0044048} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 108 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFAKRGTLGLFDYEDHLADLDSSESHHMNSLSSIRRDFRGVVDSCCRKSCSFSTLRAYCDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of INSL5_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of INSL5_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of INSL5_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of INSL5_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
INSL2_DROME | Ilp2 | genetic | 25101872 | |
INSL5_DROME | Ilp5 | physical | 20974844 | |
IMPL2_DROME | ImpL2 | physical | 23307869 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...