IL6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IL6_HUMAN
• UniProt AC: P05231
• Protein Name: Interleukin-6
• Gene Name: IL6
• Organism: Homo sapiens (Human).
• Sequence Length: 212
• Subcellular Localization: Secreted.
• Protein Description: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation..
• Protein Sequence: MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Sulfoxidation	HRQPLTSSERIDKQI CCCCCCCHHHHHHHH	26.17	1901038
68	Sulfoxidation	LDGISALRKETCNKS HHHHHHHHHHHCCCC	34.18	1901038
73	N-linked_Glycosylation	ALRKETCNKSNMCES HHHHHHCCCCCCCHH	59.20	14970177
73	N-linked_Glycosylation	ALRKETCNKSNMCES HHHHHHCCCCCCCHH	59.20	14970177
75	Phosphorylation	RKETCNKSNMCESSK HHHHCCCCCCCHHHH	18.79	24505115
80	Phosphorylation	NKSNMCESSKEALAE CCCCCCHHHHHHHHH	41.61	24505115
81	Phosphorylation	KSNMCESSKEALAEN CCCCCHHHHHHHHHC	16.54	1883960
94	Ubiquitination	ENNLNLPKMAEKDGC HCCCCCCHHHHHCCC	54.64	-
118	Sulfoxidation	CLVKIITGLLEFEVY HHHHHHHHHHHHHHH	20.18	1901038
135	Phosphorylation	YLQNRFESSEEQARA HHHHHCCCHHHHHHH	40.10	-
136	Phosphorylation	LQNRFESSEEQARAV HHHHCCCHHHHHHHH	37.64	-
146	Phosphorylation	QARAVQMSTKVLIQF HHHHHHHHHHHHHHH	14.16	22210691
162	Sulfoxidation	QKKAKNLDAITTPDP HHHHCCCCCCCCCCC	45.37	1901038
165	Phosphorylation	AKNLDAITTPDPTTN HCCCCCCCCCCCCCC	33.71	27174698
166	O-linked_Glycosylation	KNLDAITTPDPTTNA CCCCCCCCCCCCCCH	21.41	14970177
166	O-linked_Glycosylation	KNLDAITTPDPTTNA CCCCCCCCCCCCCCH	21.41	14970177
166	Phosphorylation	KNLDAITTPDPTTNA CCCCCCCCCCCCCCH	21.41	27174698
170	O-linked_Glycosylation	AITTPDPTTNASLLT CCCCCCCCCCHHHHH	39.81	14970177
170	Phosphorylation	AITTPDPTTNASLLT CCCCCCCCCCHHHHH	39.81	27174698
170	O-linked_Glycosylation	AITTPDPTTNASLLT CCCCCCCCCCHHHHH	39.81	14970177
171	O-linked_Glycosylation	ITTPDPTTNASLLTK CCCCCCCCCHHHHHH	33.89	14970177
171	Phosphorylation	ITTPDPTTNASLLTK CCCCCCCCCHHHHHH	33.89	27174698
171	O-linked_Glycosylation	ITTPDPTTNASLLTK CCCCCCCCCHHHHHH	33.89	14970177
174	Phosphorylation	PDPTTNASLLTKLQA CCCCCCHHHHHHHHH	26.44	24719451
177	Phosphorylation	TTNASLLTKLQAQNQ CCCHHHHHHHHHHHH	34.69	27174698
185	Sulfoxidation	KLQAQNQWLQDMTTH HHHHHHHHHHHHHHH	11.98	1901038

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
81	S	Phosphorylation	Kinase	FAM20C	Q8IXL6	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IL6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IL6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IL6RA_HUMAN	IL6R	physical	14557255
SH3G2_HUMAN	SH3GL2	physical	16169070
ZBT16_HUMAN	ZBTB16	physical	25241761
HRH1_HUMAN	HRH1	physical	25241761

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• 604302: Rheumatoid arthritis systemic juvenile (RASJ)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.