UniProt ID | HXC4_MOUSE | |
---|---|---|
UniProt AC | Q08624 | |
Protein Name | Homeobox protein Hox-C4 | |
Gene Name | Hoxc4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 264 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.. | |
Protein Sequence | MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRAHGPAQAGHHHPEKSQPLCEPAPLSGTSASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MIMSSYLMDSN ----CCCCCCCCCCC | 12.61 | 25293948 | |
5 | Phosphorylation | ---MIMSSYLMDSNY ---CCCCCCCCCCCC | 12.61 | 25293948 | |
6 | Phosphorylation | --MIMSSYLMDSNYI --CCCCCCCCCCCCC | 9.95 | 25293948 | |
10 | Phosphorylation | MSSYLMDSNYIDPKF CCCCCCCCCCCCCCC | 19.98 | 25293948 | |
12 | Phosphorylation | SYLMDSNYIDPKFPP CCCCCCCCCCCCCCC | 15.62 | 25293948 | |
70 | Phosphorylation | PERQYSCTSLQGPGN CCCCCCCCCCCCCCC | 26.91 | - | |
251 | Phosphorylation | EDHSQSATPPEQQRA CCCCCCCCCHHHHHH | 44.62 | 25338131 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXC4_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXC4_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXC4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PBX1_MOUSE | Pbx1 | physical | 20211142 | |
PBX3_MOUSE | Pbx3 | physical | 20211142 | |
PO2F1_MOUSE | Pou2f1 | physical | 20211142 | |
SALL4_MOUSE | Sall4 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...