dbPTM

HXC4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HXC4_MOUSE
UniProt AC	Q08624
Protein Name	Homeobox protein Hox-C4
Gene Name	Hoxc4
Organism	Mus musculus (Mouse).
Sequence Length	264
Subcellular Localization	Nucleus.
Protein Description	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
Protein Sequence	MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPGNSRAHGPAQAGHHHPEKSQPLCEPAPLSGTSASPSPAPPACSQPAPDHPSSAASKQPIVYPWMKKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MIMSSYLMDSN ----CCCCCCCCCCC	12.61	25293948
5	Phosphorylation	---MIMSSYLMDSNY ---CCCCCCCCCCCC	12.61	25293948
6	Phosphorylation	--MIMSSYLMDSNYI --CCCCCCCCCCCCC	9.95	25293948
10	Phosphorylation	MSSYLMDSNYIDPKF CCCCCCCCCCCCCCC	19.98	25293948
12	Phosphorylation	SYLMDSNYIDPKFPP CCCCCCCCCCCCCCC	15.62	25293948
70	Phosphorylation	PERQYSCTSLQGPGN CCCCCCCCCCCCCCC	26.91	-
251	Phosphorylation	EDHSQSATPPEQQRA CCCCCCCCCHHHHHH	44.62	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HXC4_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HXC4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HXC4_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PBX1_MOUSE	Pbx1	physical	20211142
PBX3_MOUSE	Pbx3	physical	20211142
PO2F1_MOUSE	Pou2f1	physical	20211142
SALL4_MOUSE	Sall4	physical	20211142

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HXC4_MOUSE

Related Literatures of Post-Translational Modification