HXA6_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HXA6_MOUSE
• UniProt AC: P09092
• Protein Name: Homeobox protein Hox-A6
• Gene Name: Hoxa6
• Organism: Mus musculus (Mouse).
• Sequence Length: 232
• Subcellular Localization: Nucleus.
• Protein Description: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
• Protein Sequence: MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNNKQRGPGDYLHFSPEQQYKPDGSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	LACNRASYEYGASCF EEECCCHHCCCCCCE	16.52	24719451
89	Phosphorylation	DKDLSGASPSGNNKQ CCCCCCCCCCCCCCC	24.11	24719451
166	Phosphorylation	QTYTRYQTLELEKEF CEEEEEEEEHHHHHH	17.17	28285833

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HXA6_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HXA6_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HXA6_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PBX1_MOUSE	Pbx1	physical	20211142
PBX3_MOUSE	Pbx3	physical	20211142
PO2F1_MOUSE	Pou2f1	physical	20211142
RPB9_MOUSE	Polr2i	physical	20211142
PKNX2_MOUSE	Pknox2	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.