HUA1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HUA1_SCHPO
• UniProt AC: O13772
• Protein Name: Proline/serine-rich protein C17A5.10
• Gene Name: SPAC17A5.10
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 224
• Subcellular Localization: Cytoplasm .
• Protein Description: May be involved in assembly and disassembly of the actin cytoskeleton..
• Protein Sequence: MTDDSVPPPSYEEVLRQEGVIDSPNSSNGQTSTSAGHPSSSSSTLPNYAASSLNSRPVSSSGSGNAYSQAPYPPARPTSQRPNSWQPGNASTMYASPPPSSNYNTAKPPYQTSQFYARPQSSYAPPPSGRPRISYPYPPGYMCYKCHNTGYKDSGRPCGRCARRFGRSYDVQFSRPPPGALVVYPGDPRIPGRVCGNCKGSGQLDFIFFTEICPVCNGVGKIPY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of HUA1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HUA1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HUA1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HUA1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YKX4_SCHPO	SPAC328.04	physical	23695164
MOC3_SCHPO	moc3	physical	23695164
HUA1_SCHPO	SPAC17A5.10	physical	23695164
RAD18_SCHPO	rhp18	physical	23695164
HUA1_SCHPO	SPAC17A5.10	physical	26771498
YKX4_SCHPO	SPAC328.04	physical	26771498
UBP2_SCHPO	ubp2	physical	26771498
MOC3_SCHPO	moc3	physical	26771498
PUB3_SCHPO	pub3	physical	26771498
RAD18_SCHPO	rhp18	physical	26771498
CSK2C_SCHPO	ckb2	physical	26771498
PVG4_SCHPO	mbx2	physical	26771498
UBP21_SCHPO	ubp15	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.