| UniProt ID | HPGDS_HUMAN | |
|---|---|---|
| UniProt AC | O60760 | |
| Protein Name | Hematopoietic prostaglandin D synthase | |
| Gene Name | HPGDS | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 199 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide.. | |
| Protein Sequence | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MPNYKLTYFNM ----CCCCEEEEEEC | 11.08 | 24043423 | |
| 7 | O-linked_Glycosylation | -MPNYKLTYFNMRGR -CCCCEEEEEECCCH | 23.16 | 30379171 | |
| 7 | Phosphorylation | -MPNYKLTYFNMRGR -CCCCEEEEEECCCH | 23.16 | 24043423 | |
| 8 | Phosphorylation | MPNYKLTYFNMRGRA CCCCEEEEEECCCHH | 11.91 | 24043423 | |
| 121 | Phosphorylation | QMFNELLTYNAPHLM HHHHHHHHCCCHHHH | 27.62 | 24043423 | |
| 122 | Phosphorylation | MFNELLTYNAPHLMQ HHHHHHHCCCHHHHH | 14.86 | 24043423 | |
| 133 | Phosphorylation | HLMQDLDTYLGGREW HHHHHHHHHCCCCCE | 28.13 | 24043423 | |
| 134 | Phosphorylation | LMQDLDTYLGGREWL HHHHHHHHCCCCCEE | 11.74 | 24043423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPGDS_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPGDS_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPGDS_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HPGDS_HUMAN | HPGDS | physical | 18341273 | |
| ARRD3_HUMAN | ARRDC3 | physical | 25416956 | |
| AB17A_HUMAN | ABHD17A | physical | 25416956 | |
| HPGDS_HUMAN | HPGDS | physical | 22418579 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
