HLF_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HLF_HUMAN
• UniProt AC: Q16534
• Protein Name: Hepatic leukemia factor
• Gene Name: HLF
• Organism: Homo sapiens (Human).
• Sequence Length: 295
• Subcellular Localization: Nucleus .
• Protein Sequence: MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Ubiquitination	-----MEKMSRPLPL -----CCCCCCCCCC	40.66	-
19	Phosphorylation	PTFIPPPYGVLRSLL CCCCCCCHHHHHHHH	26.16	22468782
54	Phosphorylation	EKKLDDESNSPTVPQ HHCCCCCCCCCCCCH	49.99	24850871
56	Phosphorylation	KLDDESNSPTVPQSA CCCCCCCCCCCCHHH	31.09	24850871
58	Phosphorylation	DDESNSPTVPQSAFL CCCCCCCCCCHHHHC	44.64	24850871
62	Phosphorylation	NSPTVPQSAFLGPTL CCCCCCHHHHCCCCC	18.21	24850871
201	Phosphorylation	DPRKRKFSEEELKPQ CCCCCCCCHHHHCCC	47.32	21815630

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HLF_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HLF_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HLF_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HNF4G_HUMAN	HNF4G	physical	20211142
MYB_HUMAN	MYB	physical	20211142
TLK1_HUMAN	TLK1	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.