| UniProt ID | HHAT_DROME | |
|---|---|---|
| UniProt AC | Q9VZU2 | |
| Protein Name | Protein-cysteine N-palmitoyltransferase Rasp | |
| Gene Name | rasp | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 500 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | Required in hedgehog (hh) expressing cells for production of appropriate signaling activity in embryos and in the imaginal precursors of adult tissues. Acts within the secretory pathway to catalyze N-terminal palmitoylation of Hh; this lipid modification is required for the embryonic and larval patterning activities of the Hh signal. Not required for Wg signaling.. | |
| Protein Sequence | MSRLPDRSLLTRCEIFVYFGVYIAYIVVGLYKIYGLRDHIVKEAKFQFPEGWSLYPFSQRRRDDSNDELENFGDFIVSFWPFYLLHVAVQGFIRWKRPRLQCLGFIGVCALALSVNLDWSSMVLLVTLIASYYIVSLLSLKFLVWLLSAGWILCINVMQKNVWWTDRVGYTEYVLVIVTMSWSVLRGCSYSLSKIGAKQEDLTRYSLVQYLGYAMYFPCLTYGPIISYQRFAARREDEVQNWLGFVGGVLRSAIWWLVMQCALHYFYIHYMSRDVRMVEMMDSVFWQHSAGYFMGQFFFLYYVVTYGLGIAFAVQDGIPAPNRPRCIGRIHFYSDMWKYFDEGLYEFLFQNIYAELCGKRSSAAAKFGATALTFAFVFVWHGCYTYVLIWSILNFLCLAAEKVFKTFTAMPEYQRWTQRHLGAVGAQRLYAMLATQLFIPAAFSNVYFIGGQEIGDFLMRGAYLSGVGNYVALCFCSYCFFQCSELLLTKSDGRSKTKTF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of HHAT_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HHAT_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HHAT_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HHAT_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARP5_DROME | Arp5 | physical | 14605208 | |
| SPITZ_DROME | spi | physical | 16459296 | |
| SPITZ_DROME | spi | physical | 23112049 | |
| HH_DROME | hh | physical | 23112049 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
