HESX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HESX1_MOUSE
• UniProt AC: Q61658
• Protein Name: Homeobox expressed in ES cells 1
• Gene Name: Hesx1
• Organism: Mus musculus (Mouse).
• Sequence Length: 185
• Subcellular Localization: Nucleus .
• Protein Description: Required for the normal development of the forebrain, eyes and other anterior structures such as the olfactory placodes and pituitary gland. Possible transcriptional repressor. Binds to the palindromic PIII sequence, 5'-AGCTTGAGTCTAATTGAATTAACTGTAC-3'. HESX1 and PROP1 bind as heterodimers on this palindromic site, and, in vitro, HESX1 can antagonize PROP1 activation..
• Protein Sequence: MSPSLREGAQLRESKPAPCSFSIESILGLDQKKDCTTSVRPHRPWTDTCGDSEKGGNPPLHAPDLPSETSFPCPVDHPRPEERAPKYENYFSASETRSLKRELSWYRGRRPRTAFTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQFLMAKKPFNPDLLK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of HESX1_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HESX1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HESX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HESX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DNMT1_MOUSE	Dnmt1	physical	17931718
LONP2_MOUSE	Lonp2	physical	17931718
SRFB1_MOUSE	Srfbp1	physical	17931718
ZN592_MOUSE	Zfp592	physical	17931718
SAFB1_MOUSE	Safb	physical	17931718

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.