UniProt ID | HBG1_HUMAN | |
---|---|---|
UniProt AC | P69891 | |
Protein Name | Hemoglobin subunit gamma-1 | |
Gene Name | HBG1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 147 | |
Subcellular Localization | ||
Protein Description | Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.. | |
Protein Sequence | MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MGHFTEEDK ------CCCCCHHHH | 25.31 | 5554303 | |
5 | Phosphorylation | ---MGHFTEEDKATI ---CCCCCHHHHHHH | 32.56 | 24719451 | |
9 | Acetylation | GHFTEEDKATITSLW CCCCHHHHHHHHHHH | 51.19 | 30584525 | |
9 | Ubiquitination | GHFTEEDKATITSLW CCCCHHHHHHHHHHH | 51.19 | - | |
11 | Phosphorylation | FTEEDKATITSLWGK CCHHHHHHHHHHHEE | 30.45 | 23186163 | |
13 | Phosphorylation | EEDKATITSLWGKVN HHHHHHHHHHHEEEC | 17.26 | 23186163 | |
14 | Phosphorylation | EDKATITSLWGKVNV HHHHHHHHHHEEECH | 20.48 | 23917254 | |
18 | Ubiquitination | TITSLWGKVNVEDAG HHHHHHEEECHHHCC | 21.03 | - | |
28 | Phosphorylation | VEDAGGETLGRLLVV HHHCCCCCCHHHEEE | 37.47 | 28857561 | |
36 | Phosphorylation | LGRLLVVYPWTQRFF CHHHEEEECCHHHHH | 5.88 | 24927040 | |
39 | Phosphorylation | LLVVYPWTQRFFDSF HEEEECCHHHHHHHC | 12.83 | 28857561 | |
45 | Phosphorylation | WTQRFFDSFGNLSSA CHHHHHHHCCCCCCH | 29.87 | 23917254 | |
50 | Phosphorylation | FDSFGNLSSASAIMG HHHCCCCCCHHHHCC | 28.05 | 30242111 | |
51 | Phosphorylation | DSFGNLSSASAIMGN HHCCCCCCHHHHCCC | 29.43 | 30242111 | |
53 | Phosphorylation | FGNLSSASAIMGNPK CCCCCCHHHHCCCCC | 21.92 | 30242111 | |
60 | Acetylation | SAIMGNPKVKAHGKK HHHCCCCCHHHHHHH | 61.44 | 30584537 | |
60 | Ubiquitination | SAIMGNPKVKAHGKK HHHCCCCCHHHHHHH | 61.44 | - | |
62 | Acetylation | IMGNPKVKAHGKKVL HCCCCCHHHHHHHHH | 40.57 | 7289963 | |
62 | Ubiquitination | IMGNPKVKAHGKKVL HCCCCCHHHHHHHHH | 40.57 | - | |
66 | Acetylation | PKVKAHGKKVLTSLG CCHHHHHHHHHHHHH | 29.82 | 30584543 | |
66 | Ubiquitination | PKVKAHGKKVLTSLG CCHHHHHHHHHHHHH | 29.82 | - | |
67 | Ubiquitination | KVKAHGKKVLTSLGD CHHHHHHHHHHHHHH | 47.25 | - | |
70 | Phosphorylation | AHGKKVLTSLGDAIK HHHHHHHHHHHHHHH | 25.54 | 28857561 | |
71 | Phosphorylation | HGKKVLTSLGDAIKH HHHHHHHHHHHHHHC | 26.62 | 28857561 | |
77 | Ubiquitination | TSLGDAIKHLDDLKG HHHHHHHHCHHHHCC | 39.57 | - | |
77 | Acetylation | TSLGDAIKHLDDLKG HHHHHHHHCHHHHCC | 39.57 | 30584549 | |
83 | Acetylation | IKHLDDLKGTFAQLS HHCHHHHCCHHHHHH | 64.00 | 156737 | |
83 | Ubiquitination | IKHLDDLKGTFAQLS HHCHHHHCCHHHHHH | 64.00 | - | |
94 | S-nitrosylation | AQLSELHCDKLHVDP HHHHHHCCCCCCCCH | 8.46 | - | |
96 | Ubiquitination | LSELHCDKLHVDPEN HHHHCCCCCCCCHHH | 45.98 | - | |
96 | Acetylation | LSELHCDKLHVDPEN HHHHCCCCCCCCHHH | 45.98 | 30584531 | |
113 | Phosphorylation | LLGNVLVTVLAIHFG HHHHHHHHHHHHHHC | 12.97 | - | |
124 | Phosphorylation | IHFGKEFTPEVQASW HHHCCCCCHHHHHHH | 21.45 | 30242111 | |
130 | Phosphorylation | FTPEVQASWQKMVTA CCHHHHHHHHHHHHH | 16.98 | 28857561 | |
136 | Phosphorylation | ASWQKMVTAVASALS HHHHHHHHHHHHHHH | 16.35 | 30242111 | |
140 | Phosphorylation | KMVTAVASALSSRYH HHHHHHHHHHHHCCC | 24.12 | 6199326 | |
143 | Phosphorylation | TAVASALSSRYH--- HHHHHHHHHCCC--- | 16.70 | 30242111 | |
144 | Phosphorylation | AVASALSSRYH---- HHHHHHHHCCC---- | 37.39 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HBG1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
2 | G | Acetylation |
| 5554303 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HBG1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
KR109_HUMAN | KRTAP10-9 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...