UniProt ID | HAND1_MOUSE | |
---|---|---|
UniProt AC | Q64279 | |
Protein Name | Heart- and neural crest derivatives-expressed protein 1 | |
Gene Name | Hand1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 216 | |
Subcellular Localization | Nucleus, nucleoplasm . Nucleus, nucleolus . Interaction with MDFIC sequesters it into the nucleolus, preventing the transcription factor activity. Phosphorylation by PLK4 disrupts the interaction with MDFIC and releases it from the nucleolus, leading | |
Protein Description | Transcription factor that plays an essential role in both trophoblast-giant cells differentiation and in cardiac morphogenesis. In the adult, could be required for ongoing expression of cardiac-specific genes. Binds the DNA sequence 5'-NRTCTG-3' (non-canonical E-box).. | |
Protein Sequence | MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRELPQQPESFPPASGPGEKRIKGRTGWPQQVWALELNQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
107 | T | Phosphorylation | Kinase | PLK4 | O00444 | PSP |
107 | T | Phosphorylation | Kinase | PLK4 | Q64702 | Uniprot |
109 | S | Phosphorylation | Kinase | PLK4 | O00444 | PSP |
109 | S | Phosphorylation | Kinase | PLK4 | Q64702 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAND1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAND1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HTF4_MOUSE | Tcf12 | physical | 20211142 | |
FHL2_MOUSE | Fhl2 | physical | 15509787 | |
SOX15_MOUSE | Sox15 | physical | 16759287 | |
NKX25_MOUSE | Nkx2-5 | physical | 12392994 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Nucleolar release of Hand1 acts as a molecular switch to determinecell fate."; Martindill D.M.J., Risebro C.A., Smart N., Franco-Viseras Mdel M.,Rosario C.O., Swallow C.J., Dennis J.W., Riley P.R.; Nat. Cell Biol. 9:1131-1141(2007). Cited for: SUBCELLULAR LOCATION, INTERACTION WITH MDFIC, PHOSPHORYLATION ATTHR-107 AND SER-109, AND MUTAGENESIS OF THR-107 AND SER-109. |