| UniProt ID | HAND1_MOUSE | |
|---|---|---|
| UniProt AC | Q64279 | |
| Protein Name | Heart- and neural crest derivatives-expressed protein 1 | |
| Gene Name | Hand1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 216 | |
| Subcellular Localization | Nucleus, nucleoplasm . Nucleus, nucleolus . Interaction with MDFIC sequesters it into the nucleolus, preventing the transcription factor activity. Phosphorylation by PLK4 disrupts the interaction with MDFIC and releases it from the nucleolus, leading | |
| Protein Description | Transcription factor that plays an essential role in both trophoblast-giant cells differentiation and in cardiac morphogenesis. In the adult, could be required for ongoing expression of cardiac-specific genes. Binds the DNA sequence 5'-NRTCTG-3' (non-canonical E-box).. | |
| Protein Sequence | MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPTTAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRELPQQPESFPPASGPGEKRIKGRTGWPQQVWALELNQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 107 | T | Phosphorylation | Kinase | PLK4 | O00444 | PSP |
| 107 | T | Phosphorylation | Kinase | PLK4 | Q64702 | Uniprot |
| 109 | S | Phosphorylation | Kinase | PLK4 | O00444 | PSP |
| 109 | S | Phosphorylation | Kinase | PLK4 | Q64702 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAND1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAND1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HTF4_MOUSE | Tcf12 | physical | 20211142 | |
| FHL2_MOUSE | Fhl2 | physical | 15509787 | |
| SOX15_MOUSE | Sox15 | physical | 16759287 | |
| NKX25_MOUSE | Nkx2-5 | physical | 12392994 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Nucleolar release of Hand1 acts as a molecular switch to determinecell fate."; Martindill D.M.J., Risebro C.A., Smart N., Franco-Viseras Mdel M.,Rosario C.O., Swallow C.J., Dennis J.W., Riley P.R.; Nat. Cell Biol. 9:1131-1141(2007). Cited for: SUBCELLULAR LOCATION, INTERACTION WITH MDFIC, PHOSPHORYLATION ATTHR-107 AND SER-109, AND MUTAGENESIS OF THR-107 AND SER-109. | |