UniProt ID | H2A1D_HUMAN | |
---|---|---|
UniProt AC | P20671 | |
Protein Name | Histone H2A type 1-D | |
Gene Name | HIST1H2AD | |
Organism | Homo sapiens (Human). | |
Sequence Length | 130 | |
Subcellular Localization | Nucleus. Chromosome. | |
Protein Description | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. | |
Protein Sequence | MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSGRGKQGG ------CCCCCCCCC | 36.88 | 15823041 | |
2 | Acetylation | ------MSGRGKQGG ------CCCCCCCCC | 36.88 | 15823041 | |
4 | Citrullination | ----MSGRGKQGGKA ----CCCCCCCCCHH | 41.66 | - | |
4 | Methylation | ----MSGRGKQGGKA ----CCCCCCCCCHH | 41.66 | - | |
4 | Citrullination | ----MSGRGKQGGKA ----CCCCCCCCCHH | 41.66 | 15823041 | |
6 | Methylation | --MSGRGKQGGKARA --CCCCCCCCCHHCH | 44.39 | - | |
6 | Acetylation | --MSGRGKQGGKARA --CCCCCCCCCHHCH | 44.39 | - | |
6 | Other | --MSGRGKQGGKARA --CCCCCCCCCHHCH | 44.39 | 24681537 | |
10 | Acetylation | GRGKQGGKARAKAKT CCCCCCCHHCHHHHH | 41.34 | 22389435 | |
10 | Lactoylation | GRGKQGGKARAKAKT CCCCCCCHHCHHHHH | 41.34 | - | |
10 | Other | GRGKQGGKARAKAKT CCCCCCCHHCHHHHH | 41.34 | 27105115 | |
10 | Succinylation | GRGKQGGKARAKAKT CCCCCCCHHCHHHHH | 41.34 | 22389435 | |
14 | Acetylation | QGGKARAKAKTRSSR CCCHHCHHHHHHHHC | 44.88 | - | |
14 | Ubiquitination | QGGKARAKAKTRSSR CCCHHCHHHHHHHHC | 44.88 | 22980979 | |
14 | Other | QGGKARAKAKTRSSR CCCHHCHHHHHHHHC | 44.88 | 27105115 | |
16 | Ubiquitination | GKARAKAKTRSSRAG CHHCHHHHHHHHCCC | 43.71 | 22980979 | |
17 | Phosphorylation | KARAKAKTRSSRAGL HHCHHHHHHHHCCCC | 40.41 | 23882029 | |
19 | Phosphorylation | RAKAKTRSSRAGLQF CHHHHHHHHCCCCCC | 29.43 | 23312004 | |
20 | Phosphorylation | AKAKTRSSRAGLQFP HHHHHHHHCCCCCCC | 23.90 | 27966365 | |
21 | Methylation | KAKTRSSRAGLQFPV HHHHHHHCCCCCCCH | 33.64 | - | |
30 | Methylation | GLQFPVGRVHRLLRK CCCCCHHHHHHHHHC | 22.69 | - | |
37 | Other | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | 27105115 | |
37 | N6-crotonyl-L-lysine | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | - | |
37 | Crotonylation | RVHRLLRKGNYSERV HHHHHHHCCCCHHCC | 52.02 | 21925322 | |
58 | Phosphorylation | YLAAVLEYLTAEILE HHHHHHHHHHHHHHH | 12.75 | - | |
75 | Other | GNAARDNKKTRIIPR CHHHHCCCCCCEEHH | 60.87 | 24681537 | |
76 | Other | NAARDNKKTRIIPRH HHHHCCCCCCEEHHH | 49.65 | 24681537 | |
77 | Phosphorylation | AARDNKKTRIIPRHL HHHCCCCCCEEHHHH | 28.80 | 23882029 | |
82 | Methylation | KKTRIIPRHLQLAIR CCCCEEHHHHHHHHC | 32.51 | - | |
89 | Methylation | RHLQLAIRNDEELNK HHHHHHHCCHHHHHH | 38.65 | - | |
96 | Succinylation | RNDEELNKLLGKVTI CCHHHHHHHHCCEEE | 58.68 | 22389435 | |
96 | Other | RNDEELNKLLGKVTI CCHHHHHHHHCCEEE | 58.68 | 27105115 | |
96 | Ubiquitination | RNDEELNKLLGKVTI CCHHHHHHHHCCEEE | 58.68 | 22389435 | |
96 | Glutarylation | RNDEELNKLLGKVTI CCHHHHHHHHCCEEE | 58.68 | 31542297 | |
96 | Acetylation | RNDEELNKLLGKVTI CCHHHHHHHHCCEEE | 58.68 | 73276671 | |
100 | Ubiquitination | ELNKLLGKVTIAQGG HHHHHHCCEEECCCC | 35.85 | 21906983 | |
100 | Glutarylation | ELNKLLGKVTIAQGG HHHHHHCCEEECCCC | 35.85 | 31542297 | |
102 | Phosphorylation | NKLLGKVTIAQGGVL HHHHCCEEECCCCCC | 17.68 | 24732914 | |
105 | Methylation | LGKVTIAQGGVLPNI HCCEEECCCCCCCCE | 45.37 | 24352239 | |
119 | Other | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | 27105115 | |
119 | Crotonylation | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | 21925322 | |
119 | Sumoylation | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | - | |
119 | Glutarylation | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | 31542297 | |
119 | N6-crotonyl-L-lysine | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | - | |
119 | Ubiquitination | IQAVLLPKKTESHHK EEEEECCCCCHHHHH | 72.76 | - | |
120 | N6-crotonyl-L-lysine | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | - | |
120 | Glutarylation | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 31542297 | |
120 | Crotonylation | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 21925322 | |
120 | Sumoylation | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | - | |
120 | Ubiquitination | QAVLLPKKTESHHKA EEEECCCCCHHHHHC | 56.43 | 25470042 | |
121 | Phosphorylation | AVLLPKKTESHHKAK EEECCCCCHHHHHCC | 49.17 | 25159151 | |
123 | Phosphorylation | LLPKKTESHHKAKGK ECCCCCHHHHHCCCC | 35.80 | 25159151 | |
126 | Crotonylation | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | 21925322 | |
126 | Ubiquitination | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | - | |
126 | N6-crotonyl-L-lysine | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | - | |
126 | Glutarylation | KKTESHHKAKGK--- CCCHHHHHCCCC--- | 46.50 | 31542297 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
2 | S | Phosphorylation | Kinase | RPS6KA5 | O75582 | Uniprot |
121 | T | Phosphorylation | Kinase | DCAF1 | Q9Y4B6 | Uniprot |
- | K | Ubiquitination | E3 ubiquitin ligase | BMI1 | P35226 | PMID:16359901 |
- | K | Ubiquitination | E3 ubiquitin ligase | BMI1#RNF2 | P35226#Q99496 | PMID:22199232 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
2 | S | Acetylation |
| 15010469 |
2 | S | Phosphorylation |
| 15010469 |
2 | S | Phosphorylation |
| 15010469 |
2 | S | Phosphorylation |
| 15010469 |
4 | R | Methylation |
| 15823041 |
14 | K | ubiquitylation |
| 22980979 |
14 | K | ubiquitylation |
| 22980979 |
16 | K | ubiquitylation |
| 22980979 |
16 | K | ubiquitylation |
| 22980979 |
27 | K | Methylation |
| 15386022 |
27 | K | ubiquitylation |
| 15386022 |
63 | K | ubiquitylation |
| 15386022 |
105 | Q | Methylation |
| 24352239 |
120 | K | ubiquitylation |
| 15386022 |
120 | K | ubiquitylation |
| 15386022 |
121 | T | Phosphorylation |
| 15078818 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of H2A1D_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS4X_HUMAN | RPS4X | physical | 22939629 | |
H2B1B_HUMAN | HIST1H2BB | physical | 22939629 | |
RS3_HUMAN | RPS3 | physical | 22939629 | |
RL7_HUMAN | RPL7 | physical | 22939629 | |
RS6_HUMAN | RPS6 | physical | 22939629 | |
RL18_HUMAN | RPL18 | physical | 22939629 | |
RS23_HUMAN | RPS23 | physical | 22939629 | |
RS15A_HUMAN | RPS15A | physical | 22939629 | |
H2AV_HUMAN | H2AFV | physical | 22939629 | |
RL37A_HUMAN | RPL37A | physical | 22939629 | |
RS24_HUMAN | RPS24 | physical | 22939629 | |
RS13_HUMAN | RPS13 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Precise characterization of human histones in the H2A gene family bytop down mass spectrometry."; Boyne M.T. II, Pesavento J.J., Mizzen C.A., Kelleher N.L.; J. Proteome Res. 5:248-253(2006). Cited for: MASS SPECTROMETRY, AND ACETYLATION AT SER-2. | |
"Deimination of histone H2A and H4 at arginine 3 in HL-60granulocytes."; Hagiwara T., Hidaka Y., Yamada M.; Biochemistry 44:5827-5834(2005). Cited for: ACETYLATION AT SER-2, CITRULLINATION AT ARG-4, AND MASS SPECTROMETRY. | |
Ubiquitylation | |
Reference | PubMed |
"DNA damage triggers nucleotide excision repair-dependentmonoubiquitylation of histone H2A."; Bergink S., Salomons F.A., Hoogstraten D., Groothuis T.A.M.,de Waard H., Wu J., Yuan L., Citterio E., Houtsmuller A.B.,Neefjes J., Hoeijmakers J.H.J., Vermeulen W., Dantuma N.P.; Genes Dev. 20:1343-1352(2006). Cited for: UBIQUITINATION AT LYS-120. | |
"Role of Bmi-1 and Ring1A in H2A ubiquitylation and Hox genesilencing."; Cao R., Tsukada Y., Zhang Y.; Mol. Cell 20:845-854(2005). Cited for: UBIQUITINATION AT LYS-120. | |
"Role of histone H2A ubiquitination in Polycomb silencing."; Wang H., Wang L., Erdjument-Bromage H., Vidal M., Tempst P.,Jones R.S., Zhang Y.; Nature 431:873-878(2004). Cited for: UBIQUITINATION AT LYS-120. |