UniProt ID | GSTF2_ARATH | |
---|---|---|
UniProt AC | P46422 | |
Protein Name | Glutathione S-transferase F2 | |
Gene Name | GSTF2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 212 | |
Subcellular Localization | Cytoplasm, cytosol . Microsome . Endoplasmic reticulum . Plasma membrane vesicles. | |
Protein Description | Binds auxin, endogenous flavonoids and the phytoalexin camalexin and may be involved in regulating the binding and transport of small bioactive natural products and defense-related compounds during plant stress. Binds a series of heterocyclic compounds, including lumichrome, harmane, norharmane and indole-3-aldehyde. In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC). Acts as glutathione peroxidase on cumene hydroperoxide, linoleic acid-13-hydroperoxide and trans-stilbene oxide, but not trans-cinnamic acid or IAA-CoA.. | |
Protein Sequence | MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Phosphorylation | LFESRAITQYIAHRY HHCHHHHHHHHHHHH | 17.84 | 24299221 | |
79 | Phosphorylation | TQYIAHRYENQGTNL HHHHHHHHHCCCCCC | 14.90 | 24299221 | |
100 | Sulfoxidation | NISQYAIMAIGMQVE CHHHHHHHHHCCEEE | 1.37 | 24962998 | |
104 | Sulfoxidation | YAIMAIGMQVEDHQF HHHHHHCCEEECCCC | 3.09 | 24962998 | |
126 | Phosphorylation | AFEQIFKSIYGLTTD HHHHHHHHHHCCCCC | 15.42 | 24299221 | |
131 | Phosphorylation | FKSIYGLTTDEAVVA HHHHHCCCCCCHHHH | 28.04 | 23776212 | |
132 | Phosphorylation | KSIYGLTTDEAVVAE HHHHCCCCCCHHHHH | 36.56 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTF2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTF2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTF2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GDU2_ARATH | GDU2 | physical | 22737156 | |
PTR2_ARATH | PTR2 | physical | 22737156 | |
MLO7_ARATH | MLO7 | physical | 22737156 | |
GONS1_ARATH | GONST1 | physical | 22737156 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...