GSTF2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GSTF2_ARATH
• UniProt AC: P46422
• Protein Name: Glutathione S-transferase F2
• Gene Name: GSTF2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 212
• Subcellular Localization: Cytoplasm, cytosol . Microsome . Endoplasmic reticulum . Plasma membrane vesicles.
• Protein Description: Binds auxin, endogenous flavonoids and the phytoalexin camalexin and may be involved in regulating the binding and transport of small bioactive natural products and defense-related compounds during plant stress. Binds a series of heterocyclic compounds, including lumichrome, harmane, norharmane and indole-3-aldehyde. In vitro, possesses glutathione S-transferase activity toward 1-chloro-2,4-dinitrobenzene (CDNB) and benzyl isothiocyanate (BITC). Acts as glutathione peroxidase on cumene hydroperoxide, linoleic acid-13-hydroperoxide and trans-stilbene oxide, but not trans-cinnamic acid or IAA-CoA..
• Protein Sequence: MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLFTERPRVNEWVAEITKRPASEKVQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	LFESRAITQYIAHRY HHCHHHHHHHHHHHH	17.84	24299221
79	Phosphorylation	TQYIAHRYENQGTNL HHHHHHHHHCCCCCC	14.90	24299221
100	Sulfoxidation	NISQYAIMAIGMQVE CHHHHHHHHHCCEEE	1.37	24962998
104	Sulfoxidation	YAIMAIGMQVEDHQF HHHHHHCCEEECCCC	3.09	24962998
126	Phosphorylation	AFEQIFKSIYGLTTD HHHHHHHHHHCCCCC	15.42	24299221
131	Phosphorylation	FKSIYGLTTDEAVVA HHHHHCCCCCCHHHH	28.04	23776212
132	Phosphorylation	KSIYGLTTDEAVVAE HHHHCCCCCCHHHHH	36.56	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GSTF2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GSTF2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GSTF2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GDU2_ARATH	GDU2	physical	22737156
PTR2_ARATH	PTR2	physical	22737156
MLO7_ARATH	MLO7	physical	22737156
GONS1_ARATH	GONST1	physical	22737156

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.