GRPE2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GRPE2_HUMAN
• UniProt AC: Q8TAA5
• Protein Name: GrpE protein homolog 2, mitochondrial
• Gene Name: GRPEL2
• Organism: Homo sapiens (Human).
• Sequence Length: 225
• Subcellular Localization: Mitochondrion matrix.
• Protein Description: Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. Stimulates ATPase activity of mt-HSP70. May also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70 (By similarity)..
• Protein Sequence: MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Ubiquitination	VKAVKLEKEVQDLTV HHEEEHHHHHHHHHH	73.88	29967540
131	Phosphorylation	TECISEESEPEDQKL HHHCCCCCCCHHHHC	55.17	28985074
137	Ubiquitination	ESEPEDQKLTLEKVF CCCCHHHHCHHHHHH	56.62	29967540
142	Acetylation	DQKLTLEKVFRGLLL HHHCHHHHHHHHHHH	50.19	19608861
155	2-Hydroxyisobutyrylation	LLLEAKLKSVFAKHG HHHHHHHHHHHHHCC	43.81	-
160	Ubiquitination	KLKSVFAKHGLEKLT HHHHHHHHCCHHHCC	27.09	29967540
172	Ubiquitination	KLTPIGDKYDPHEHE HCCCCCCCCCCCCCE	46.47	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GRPE2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GRPE2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GRPE2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MUTA_HUMAN	MUT	physical	26186194
ODB2_HUMAN	DBT	physical	26186194
NDUF5_HUMAN	NDUFAF5	physical	26186194
YES_HUMAN	YES1	physical	26186194
FMC1_HUMAN	C7orf55	physical	26186194
LYRM7_HUMAN	LYRM7	physical	26186194
ODB2_HUMAN	DBT	physical	28514442
FMC1_HUMAN	C7orf55	physical	28514442
MUTA_HUMAN	MUT	physical	28514442
NDUF5_HUMAN	NDUFAF5	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-142, AND MASS SPECTROMETRY.
PubMed: 19608861