UniProt ID | GPX3_HUMAN | |
---|---|---|
UniProt AC | P22352 | |
Protein Name | Glutathione peroxidase 3 | |
Gene Name | GPX3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 226 | |
Subcellular Localization | Secreted. | |
Protein Description | Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.. | |
Protein Sequence | MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | IYEYGALTIDGEEYI EEEEECEEECCEEEE | 19.25 | - | |
59 | Phosphorylation | EYIPFKQYAGKYVLF EEEEHHHHCCEEEEE | 20.22 | - | |
155 | Phosphorylation | FYTFLKNSCPPTSEL HHHHHHCCCCCHHHH | 26.81 | 25850435 | |
159 | Phosphorylation | LKNSCPPTSELLGTS HHCCCCCHHHHCCCC | 21.70 | 25850435 | |
160 | Phosphorylation | KNSCPPTSELLGTSD HCCCCCHHHHCCCCC | 31.83 | 25850435 | |
165 | Phosphorylation | PTSELLGTSDRLFWE CHHHHCCCCCCCCCC | 27.68 | 25850435 | |
166 | Phosphorylation | TSELLGTSDRLFWEP HHHHCCCCCCCCCCC | 20.95 | 25850435 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GPX3_HUMAN | GPX3 | physical | 3693360 | |
UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
QORX_HUMAN | TP53I3 | physical | 22461624 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...