| UniProt ID | GPX3_HUMAN | |
|---|---|---|
| UniProt AC | P22352 | |
| Protein Name | Glutathione peroxidase 3 | |
| Gene Name | GPX3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 226 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione.. | |
| Protein Sequence | MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 47 | Phosphorylation | IYEYGALTIDGEEYI EEEEECEEECCEEEE | 19.25 | - | |
| 59 | Phosphorylation | EYIPFKQYAGKYVLF EEEEHHHHCCEEEEE | 20.22 | - | |
| 155 | Phosphorylation | FYTFLKNSCPPTSEL HHHHHHCCCCCHHHH | 26.81 | 25850435 | |
| 159 | Phosphorylation | LKNSCPPTSELLGTS HHCCCCCHHHHCCCC | 21.70 | 25850435 | |
| 160 | Phosphorylation | KNSCPPTSELLGTSD HCCCCCHHHHCCCCC | 31.83 | 25850435 | |
| 165 | Phosphorylation | PTSELLGTSDRLFWE CHHHHCCCCCCCCCC | 27.68 | 25850435 | |
| 166 | Phosphorylation | TSELLGTSDRLFWEP HHHHCCCCCCCCCCC | 20.95 | 25850435 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GPX3_HUMAN | GPX3 | physical | 3693360 | |
| UBQL1_HUMAN | UBQLN1 | physical | 25416956 | |
| QORX_HUMAN | TP53I3 | physical | 22461624 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...