GPVI_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GPVI_HUMAN
• UniProt AC: Q9HCN6
• Protein Name: Platelet glycoprotein VI {ECO:0000305}
• Gene Name: GP6 {ECO:0000312|HGNC:HGNC:14388}
• Organism: Homo sapiens (Human).
• Sequence Length: 339
• Subcellular Localization: Isoform 1: Cell membrane; Single-pass membrane protein.; Isoform 2: Cell membrane; Single-pass membrane protein.
• Protein Description: Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2..
• Protein Sequence: MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	Phosphorylation	LGRVPAQSGPLPKPS HCCCCCCCCCCCCCH	44.47	29449344
45	Phosphorylation	VPLEKPVTLRCQGPP CCCCCCEEEEECCCC	19.60	27251275
63	Phosphorylation	LYRLEKLSSSRYQDQ EEEEEECCCCCCCCC	37.02	27251275
64	Phosphorylation	YRLEKLSSSRYQDQA EEEEECCCCCCCCCE	29.30	27251275
65	Phosphorylation	RLEKLSSSRYQDQAV EEEECCCCCCCCCEE	31.47	27251275
67	Phosphorylation	EKLSSSRYQDQAVLF EECCCCCCCCCEEEE	20.56	18083107
92	N-linked_Glycosylation	RYRCSYQNGSLWSLP CEEEEECCCCCEECC	33.51	16014566
331 (in isoform 3)	Phosphorylation	-	38.44	25921289
342 (in isoform 3)	Phosphorylation	-		25921289
380 (in isoform 3)	Ubiquitination	-		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GPVI_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
92	N	Glycosylation	N-linked glycosylation at Asn-92 is not required for the cell surface expression, but contributes to maximal adhesion to type I collagen, collagen-related peptide (CRP), and, to a lesser extent, to the snake venom C-type lectin convulxin (CVX).	16014566

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GPVI_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LYN_HUMAN	LYN	physical	11943772
FYN_HUMAN	FYN	physical	11943772
LYN_HUMAN	LYN	physical	12594225
FCERG_HUMAN	FCER1G	physical	12594225
TRAF4_HUMAN	TRAF4	physical	20946164
TGFI1_HUMAN	TGFB1I1	physical	20946164
NCF1_HUMAN	NCF1	physical	20946164
FAK2_HUMAN	PTK2B	physical	20946164
LYN_HUMAN	LYN	physical	20946164

Drug and Disease Associations

• Kegg Disease
• H01235: Bleeding disorder platelet-type
• OMIM Disease
• 614201: Bleeding disorder, platelet-type 11 (BDPLT11)
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

N-linked Glycosylation

"The influence of N-linked glycosylation on the function of plateletglycoprotein VI.";
Kunicki T.J., Cheli Y., Moroi M., Furihata K.;
Blood 106:2744-2749(2005).
Cited for: GLYCOSYLATION AT ASN-92, AND MUTAGENESIS OF ASN-92; SER-94 AND LEU-95.
PubMed: 16014566