UniProt ID | GOLP3_DROME | |
---|---|---|
UniProt AC | Q9VQ93 | |
Protein Name | Golgi phosphoprotein 3 homolog sauron {ECO:0000305} | |
Gene Name | sau {ECO:0000312|FlyBase:FBgn0267378} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 294 | |
Subcellular Localization |
Golgi apparatus membrane Peripheral membrane protein Cytoplasmic side . Cytoplasmic vesicle . Cleavage furrow . Phosphatidylinositol 4-phosphate-binding and oligomerization participate in the recruitment onto Golgi membranes (PubMed:23720043). In |
|
Protein Description | Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. [PubMed: 19837035] | |
Protein Sequence | MNRSDGLVRRSVKPRENGGAEGGLNANTPDDNQDALDNLKDQEDNIDDGDSKETRLTLMEEVLLLGLKDKEGYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAFTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GOLP3_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GOLP3_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GOLP3_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEPT1_DROME | Sep1 | physical | 24786584 | |
MYSN_DROME | zip | physical | 24786584 | |
CLC_DROME | Clc | physical | 24786584 | |
SEPT2_DROME | Sep2 | physical | 24786584 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...