UniProt ID | SEPT2_DROME | |
---|---|---|
UniProt AC | P54359 | |
Protein Name | Septin-2 | |
Gene Name | 2-Sep | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 419 | |
Subcellular Localization | Cytoplasm. Cytoplasm, cytoskeleton, spindle. | |
Protein Description | Involved in cytokinesis.. | |
Protein Sequence | MSVEVDFVDKKEVHLRTLKQSGHVGFDSLPDQLVNKSVQNGFVFNVMCIGETGLGKSTLMDTLFNTSFESTPSPHTLPSVKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKIKRSLVTCHDSRIHICLYFICPTGHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKIIQELNANGVHIYQFPTDDETVAETNTSMNSHIPFAVVGSTEFIKVGNKLIRARQYPWGTVQVENETHCDFVKLREMLIRTNMEDMREKTHTRHYELYRQKRLEQMGFSDVDSDNKPISFQQTFEAKRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEKRKLEESRKALEEDYLDFQRRKQQLATAHHTLTLGKSKKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSVEVDFVD ------CCEEEEEEC | 27.30 | 27794539 | |
330 | Phosphorylation | QTFEAKRSNHLAELQ HHHHHHHHHHHHHHH | 28.09 | 22817900 | |
410 | Phosphorylation | QLATAHHTLTLGKSK HHHHHHHHHCCCCCC | 16.15 | 25749252 | |
412 | Phosphorylation | ATAHHTLTLGKSKKK HHHHHHHCCCCCCCC | 34.32 | 25749252 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEPT2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEPT2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEPT2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATRIP_DROME | mus304 | physical | 14605208 | |
F10A1_DROME | HIP-R | physical | 22036573 | |
F10A2_DROME | HIP-R | physical | 22036573 | |
FAT_DROME | ft | physical | 24114784 | |
PNUT_DROME | pnut | physical | 8636235 | |
PNUT_DROME | pnut | physical | 11884525 | |
HRD1_DROME | sip3 | physical | 11884525 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...