GLRX4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GLRX4_SCHPO
• UniProt AC: O74790
• Protein Name: Monothiol glutaredoxin-4
• Gene Name: grx4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 244
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters (By similarity). Binds one iron-sulfur cluster per dimer. The iron-sulfur cluster is bound between subunits, and is complexed by a bound glutathione and a cysteine residue from each subunit (By similarity)..
• Protein Sequence: MSVEITFVEQFQEILQNGKEQIILLNFYAPWAAPCKQMNQVFDQFAKDTKNAVFLKIEAEKFSDIAESFDVNAVPLFVLIHGAKVLARISGANPQKLKAAIDEYIQPLISQISSTNASVETQVNSVQTTNTTSNTSKAPNGLDSELNERLSTLTNAHNVMLFLKGTPSEPACGFSRKLVGLLREQNVQYGFFNILADDSVRQGLKVFSDWPTFPQLYIKGEFVGGLDIVSEMIENGELQEMLPN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GLRX4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GLRX4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GLRX4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GLRX4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FEP1_SCHPO	fep1	physical	21421748
DRE2_SCHPO	SPBC337.10c	physical	26771498
PHP4_SCHPO	php4	physical	25806539
FEP1_SCHPO	fep1	physical	25806539
YETB_SCHPO	fra2	physical	25806539

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.