UniProt ID | GLRX1_HUMAN | |
---|---|---|
UniProt AC | P35754 | |
Protein Name | Glutaredoxin-1 | |
Gene Name | GLRX | |
Organism | Homo sapiens (Human). | |
Sequence Length | 106 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.. | |
Protein Sequence | MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAQEFVNCK ------CCCCCCCCE | 20.01 | 19413330 | |
8 | S-nitrosocysteine | MAQEFVNCKIQPGKV CCCCCCCCEECCCCE | 3.27 | - | |
8 | S-nitrosylation | MAQEFVNCKIQPGKV CCCCCCCCEECCCCE | 3.27 | 22178444 | |
9 | Succinylation | AQEFVNCKIQPGKVV CCCCCCCEECCCCEE | 38.89 | - | |
9 | Ubiquitination | AQEFVNCKIQPGKVV CCCCCCCEECCCCEE | 38.89 | - | |
9 | Succinylation | AQEFVNCKIQPGKVV CCCCCCCEECCCCEE | 38.89 | - | |
9 | Acetylation | AQEFVNCKIQPGKVV CCCCCCCEECCCCEE | 38.89 | 23749302 | |
20 | Ubiquitination | GKVVVFIKPTCPYCR CCEEEEECCCCHHHH | 23.86 | 21890473 | |
20 | Acetylation | GKVVVFIKPTCPYCR CCEEEEECCCCHHHH | 23.86 | 23749302 | |
20 | Malonylation | GKVVVFIKPTCPYCR CCEEEEECCCCHHHH | 23.86 | 26320211 | |
22 | Phosphorylation | VVVFIKPTCPYCRRA EEEEECCCCHHHHHH | 22.55 | 28152594 | |
23 | Glutathionylation | VVFIKPTCPYCRRAQ EEEECCCCHHHHHHH | 2.83 | 9860827 | |
25 | Phosphorylation | FIKPTCPYCRRAQEI EECCCCHHHHHHHHH | 10.75 | 28152594 | |
34 | Phosphorylation | RRAQEILSQLPIKQG HHHHHHHHCCCCCCC | 35.02 | 26437602 | |
65 | O-linked_Glycosylation | QDYLQQLTGARTVPR HHHHHHHHCCCCCCE | 25.18 | 29351928 | |
79 | S-nitrosocysteine | RVFIGKDCIGGCSDL EEEECCCCCCCHHHH | 3.38 | - | |
79 | S-nitrosylation | RVFIGKDCIGGCSDL EEEECCCCCCCHHHH | 3.38 | 22178444 | |
83 | S-nitrosylation | GKDCIGGCSDLVSLQ CCCCCCCHHHHHHHH | 2.11 | 22178444 | |
83 | S-nitrosocysteine | GKDCIGGCSDLVSLQ CCCCCCCHHHHHHHH | 2.11 | - | |
84 | Phosphorylation | KDCIGGCSDLVSLQQ CCCCCCHHHHHHHHH | 36.94 | 28258704 | |
100 | Malonylation | GELLTRLKQIGALQ- HHHHHHHHHHCCCC- | 36.26 | 26320211 | |
100 | Ubiquitination | GELLTRLKQIGALQ- HHHHHHHHHHCCCC- | 36.26 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATP7A_HUMAN | ATP7A | physical | 16884690 | |
ATP7B_HUMAN | ATP7B | physical | 16884690 | |
M3K5_HUMAN | MAP3K5 | physical | 12244106 | |
AATM_HUMAN | GOT2 | physical | 21900206 | |
MMP23_HUMAN | MMP23B | physical | 21988832 | |
NIT1_HUMAN | NIT1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |