GLIS2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GLIS2_DROME
• UniProt AC: Q7K0S9
• Protein Name: Zinc finger protein GLIS2 homolog
• Gene Name: sug
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 384
• Subcellular Localization: Nucleus.
• Protein Description: Transcription factor which represses a set of lipase genes involved in fat catabolism..
• Protein Sequence: MDIIQKSIFNSGPHSRGIYEPPLGYFTPYNTPPYIAAYSDSGSWLADHHQHHQQQHQQHQQQMQHIRFPTPPITPPRPIAGYGYRQRTQSVIMKARGQQDELCRSPVEFPDDSKSCSSSSECGTASDFVCNWTDCDRVFDTLDALAQHVTQRHAIASLTDGLYYCRWRGCQRSERGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCSFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVAGCQKRYTDPSSLRKHVKTFKHSIHLIASQPLTLPSVPCLLEASSESAFTCLPAASSVESTSSSSSARYYDDSNNEPSDYSLKPKQDAEFSPSYWLGDRQHSYLHSEDFFVKMDVESPLDLRIHRI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GLIS2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GLIS2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GLIS2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GLIS2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTBP_DROME	CtBP	physical	14605208
TAMO_DROME	tamo	physical	14605208
RS29_DROME	RpS29	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.