RS29_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS29_DROME
• UniProt AC: Q9VH69
• Protein Name: 40S ribosomal protein S29
• Gene Name: RpS29
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 56
• Subcellular Localization: Cytoplasm, cytosol . Cytoplasm . Rough endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity).
• Protein Sequence: MGFATLWYSHPRKYGQGSRCCRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MGFATLWYSHPRKYG CCCCCEEECCCCCCC	10.54	18281928
9	Phosphorylation	GFATLWYSHPRKYGQ CCCCEEECCCCCCCC	18.55	21082442
53	Acetylation	YANDIGFKKLD---- HHHHCCCCCCC----	47.41	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS29_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS29_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS29_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAD2B_DROME	Ada2b	physical	14605208
OTP_DROME	otp	physical	25242320

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.