GID1A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GID1A_ARATH
• UniProt AC: Q9MAA7
• Protein Name: Gibberellin receptor GID1A
• Gene Name: GID1A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 345
• Subcellular Localization: Nucleus.
• Protein Description: Functions as soluble gibberellin (GA) receptor. GA is an essential hormone that regulates growth and development in plants. Binds with high affinity the biologically active gibberellin GA4, but has no affinity for the biologically inactive GAs. In response to GA, interacts with specific DELLA proteins, known as repressors of GA-induced growth, and targets them for degradation via proteasome. Seems to be required for GA signaling that controls root growth, seed germination, stem elongation and flower development. Partially redundant with GID1B and GID1C..
• Protein Sequence: MAASDEVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNSRSWLKSKKDSKVHIFLAGDSSGGNIAHNVALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRGKSLEGVSFPKSLVVVAGLDLIRDWQLAYAEGLKKAGQEVKLMHLEKATVGFYLLPNNNHFHNVMDEISAFVNAEC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAASDEVNL ------CCCCCCCEE	18.70	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GID1A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GID1A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GID1A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RGA_ARATH	RGA1	physical	17194763
GAI_ARATH	GAI	physical	17194763
C83B1_ARATH	CYP83B1	physical	17194763
RGL1_ARATH	RGL1	physical	21323638
SUMO1_ARATH	SUMO1	physical	24434138
RGA_ARATH	RGA1	physical	24434138
SUMO1_ARATH	SUMO1	physical	25761145
GAI_ARATH	GAI	physical	19037309

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.