GG1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GG1_ARATH
• UniProt AC: Q9FDX9
• Protein Name: Guanine nucleotide-binding protein subunit gamma 1
• Gene Name: GG1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 98
• Subcellular Localization: Cell membrane . Golgi apparatus membrane . Golgi apparatus, trans-Golgi network membrane. Cytoplasm. Localized to the cell membrane when attached to beta subunit GB1 (Probable) (PubMed:17158913). Present in the cytoplasm when associated with NUDT7 (P
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Involved in the abscisic acid (ABA) and ethylene signaling pathways. Regulates acropetal transport of auxin (IAA) in roots and hypocotyls, and thus modulates root architecture (e.g. lateral root formation). The heterotrimeric G-protein controls defense responses to necrotrophic and vascular fungi probably by modulating cell wall-related genes expression; involved in resistance to fungal pathogens such as Alternaria brassicicola, Plectosphaerella cucumerina and Fusarium oxysporum..
• Protein Sequence: MREETVVYEQEESVSHGGGKHRILAELARVEQEVAFLEKELKEVENTDIVSTVCEELLSVIEKGPDPLLPLTNGPLNLGWDRWFEGPNGGEGCRCLIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
93	S-palmitoylation	GPNGGEGCRCLIL-- CCCCCCCCEEEEC--		17220359
95	Farnesylation	NGGEGCRCLIL---- CCCCCCEEEEC----		17220359
95	Methylation	NGGEGCRCLIL---- CCCCCCEEEEC----		-
95	Farnesylation	NGGEGCRCLIL---- CCCCCCEEEEC----		17220359

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GG1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GG1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GG1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB_ARATH	AGB1	physical	11121078
GONS1_ARATH	GONST1	physical	22737156
CERK1_ARATH	CERK1	physical	26414709
Y5838_ARATH	BIR1	physical	26414709
BAK1_ARATH	BAK1	physical	26414709

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.