GBG1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG1_HUMAN
• UniProt AC: P63211
• Protein Name: Guanine nucleotide-binding protein G(T) subunit gamma-T1
• Gene Name: GNGT1
• Organism: Homo sapiens (Human).
• Sequence Length: 74
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction..
• Protein Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	VINIEDLTEKDKLKM CCCHHHCCHHHHHHH	54.00	22617229
34	Phosphorylation	TLERMLVSKCCEEVR CHHHHHHHHHHHHHH	18.93	33259812
43	Phosphorylation	CCEEVRDYVEERSGE HHHHHHHHHHHHHCC	10.13	18491316
48	Phosphorylation	RDYVEERSGEDPLVK HHHHHHHHCCCCCCC	50.22	18491316
55	Ubiquitination	SGEDPLVKGIPEDKN HCCCCCCCCCCCCCC	59.82	-
61	Ubiquitination	VKGIPEDKNPFKELK CCCCCCCCCCCHHCC	65.93	-
71	Methylation	FKELKGGCVIS---- CHHCCCCEEEC----	3.15	-
71	Farnesylation	FKELKGGCVIS---- CHHCCCCEEEC----	3.15	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB1_HUMAN	GNB1	physical	8636150
GBB2_HUMAN	GNB2	physical	8636150
GBB1_HUMAN	GNB1	physical	19168127
GBB1_HUMAN	GNB1	physical	9789084
ZN277_HUMAN	ZNF277	physical	25416956
GBB1_HUMAN	GNB1	physical	25675501
PHLP_HUMAN	PDCL	physical	25675501

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.