UniProt ID | GBB1_DROME | |
---|---|---|
UniProt AC | P26308 | |
Protein Name | Guanine nucleotide-binding protein subunit beta-1 | |
Gene Name | Gbeta13F | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 340 | |
Subcellular Localization | ||
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MNELDSLRQEAESLKNAIRDARKAACDTSLLQAATSLEPIGRIQMRTRRTLRGHLAKIYAMHWGNDSRNLVSASQDGKLIVWDSHTTNKVHAIPLRSSWVMTCAYAPSGSYVACGGLDNMCSIYNLKTREGNVRVSRELPGHGGYLSCCRFLDDNQIVTSSGDMSCGLWDIETGLQVTSFLGHTGDVMALSLAPQCKTFVSGACDASAKLWDIREGVCKQTFPGHESDINAVTFFPNGQAFATGSDDATCRLFDIRADQELAMYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTMKAERSGILAGHDNRVSCLGVTENGMAVATGSWDSFLRVWN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBB1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBB1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBB1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STC_DROME | stc | physical | 14605208 | |
GBG1_DROME | Ggamma1 | physical | 22036573 | |
PHLP_DROME | CG7650 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...