GBG1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG1_DROME
• UniProt AC: P38040
• Protein Name: Guanine nucleotide-binding protein subunit gamma-1
• Gene Name: Ggamma1
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 70
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction..
• Protein Sequence: MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Ubiquitination	ESCAKMMKYITEHEQ HHHHHHHHHHHHHHH	29.97	31113955
67	Methylation	PFREKSSCTVL---- CCCCCCCCCCC----	3.83	-
67	Geranylgeranylation	PFREKSSCTVL---- CCCCCCCCCCC----	3.83	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB1_DROME	Gbeta13F	physical	14981094

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.