UniProt ID | GBG1_DROME | |
---|---|---|
UniProt AC | P38040 | |
Protein Name | Guanine nucleotide-binding protein subunit gamma-1 | |
Gene Name | Ggamma1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 70 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.. | |
Protein Sequence | MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLLTGFTSQKVNPFREKSSCTVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Ubiquitination | ESCAKMMKYITEHEQ HHHHHHHHHHHHHHH | 29.97 | 31113955 | |
67 | Methylation | PFREKSSCTVL---- CCCCCCCCCCC---- | 3.83 | - | |
67 | Geranylgeranylation | PFREKSSCTVL---- CCCCCCCCCCC---- | 3.83 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBG1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBG1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBG1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GBB1_DROME | Gbeta13F | physical | 14981094 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...