UniProt ID | GAST_HUMAN | |
---|---|---|
UniProt AC | P01350 | |
Protein Name | Gastrin | |
Gene Name | GAST | |
Organism | Homo sapiens (Human). | |
Sequence Length | 101 | |
Subcellular Localization | Secreted. | |
Protein Description | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.. | |
Protein Sequence | MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | LAAFSEASWKPRSQQ HHHHHHHCCCCHHHC | 31.42 | 24719451 | |
59 | Pyrrolidone_carboxylic_acid | PASHHRRQLGPQGPP CCCHHHHHHCCCCCC | 51.21 | - | |
59 | Pyrrolidone_carboxylic_acid | PASHHRRQLGPQGPP CCCHHHHHHCCCCCC | 51.21 | 2730647 | |
59 | Pyrrolidone_carboxylic_acid | PASHHRRQLGPQGPP CCCHHHHHHCCCCCC | 51.21 | 2730647 | |
76 | Pyrrolidone_carboxylic_acid | VADPSKKQGPWLEEE CCCCCCCCCCCHHHH | 67.90 | - | |
76 | Pyrrolidone_carboxylic_acid | VADPSKKQGPWLEEE CCCCCCCCCCCHHHH | 67.90 | 5921183 | |
76 | Pyrrolidone_carboxylic_acid | VADPSKKQGPWLEEE CCCCCCCCCCCHHHH | 67.90 | 5921183 | |
87 | Phosphorylation | LEEEEEAYGWMDFGR HHHHHHHHCCHHCCC | 18.01 | 8578591 | |
87 | Sulfation | LEEEEEAYGWMDFGR HHHHHHHHCCHHCCC | 18.01 | - | |
87 | Sulfation | LEEEEEAYGWMDFGR HHHHHHHHCCHHCCC | 18.01 | 7530658 | |
92 | Phenylalanine amide | EAYGWMDFGRRSAED HHHCCHHCCCCCCCC | 4.79 | - | |
92 | Amidation | EAYGWMDFGRRSAED HHHCCHHCCCCCCCC | 4.79 | 5921183 | |
96 | Phosphorylation | WMDFGRRSAEDEN-- CHHCCCCCCCCCC-- | 34.35 | 9797370 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
87 | Y | Phosphorylation | Kinase | SRC | P12931 | GPS |
87 | Y | Phosphorylation | Kinase | SRC64 | - | PhosphoELM |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GAST_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GAST_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XAGE3_HUMAN | XAGE3 | physical | 28514442 | |
ATE1_HUMAN | ATE1 | physical | 28514442 | |
ZZEF1_HUMAN | ZZEF1 | physical | 28514442 | |
ZER1_HUMAN | ZER1 | physical | 28514442 | |
HECD3_HUMAN | HECTD3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Pyrrolidone carboxylic acid | |
Reference | PubMed |
"Structures of human gastrins I and II."; Bentley P.H., Kenner G.W., Sheppard R.C.; Nature 209:583-585(1966). Cited for: PROTEIN SEQUENCE OF 76-92. | |
Sulfation | |
Reference | PubMed |
"Metabolism and acid secretory effect of sulfated and nonsulfatedgastrin-6 in humans."; Palnaes Hansen C., Stadil F., Rehfeld J.F.; Am. J. Physiol. 279:G903-G909(2000). Cited for: PROTEOLYTIC PROCESSING, AND SULFATION AT TYR-87. | |
"Post-poly(Glu) cleavage and degradation modified by O-sulfatedtyrosine: a novel post-translational processing mechanism."; Rehfeld J.F., Hansen C.P., Johnsen A.H.; EMBO J. 14:389-396(1995). Cited for: PROTEOLYTIC PROCESSING, MASS SPECTROMETRY, AND SULFATION AT TYR-87. |