GA45B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GA45B_MOUSE
• UniProt AC: P22339
• Protein Name: Growth arrest and DNA damage-inducible protein GADD45 beta
• Gene Name: Gadd45b
• Organism: Mus musculus (Mouse).
• Sequence Length: 160
• Protein Description: Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK (By similarity)..
• Protein Sequence: MTLEELVASDNAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	AQRQDRLTVGVYEAA HHHCCCEEEEHHHHH	18.99	29472430
41	Phosphorylation	DRLTVGVYEAAKLMN CCEEEEHHHHHHHCC	8.23	29472430

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GA45B_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GA45B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GA45B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PCNA_HUMAN	PCNA	physical	10828065
ESR1_HUMAN	ESR1	physical	10872826
PPARA_HUMAN	PPARA	physical	10872826
PPARD_HUMAN	PPARD	physical	10872826
PPARG_HUMAN	PPARG	physical	10872826
RARA_HUMAN	RARA	physical	10872826
RXRA_HUMAN	RXRA	physical	10872826

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.