UniProt ID | FGF7_HUMAN | |
---|---|---|
UniProt AC | P21781 | |
Protein Name | Fibroblast growth factor 7 | |
Gene Name | FGF7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 194 | |
Subcellular Localization | Secreted. | |
Protein Description | Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.. | |
Protein Sequence | MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MHKWILTWILPTLL -CCHHHHHHHHHHHH | 11.00 | 25072903 | |
12 | Phosphorylation | ILTWILPTLLYRSCF HHHHHHHHHHHHHHH | 26.42 | 25072903 | |
15 | Phosphorylation | WILPTLLYRSCFHII HHHHHHHHHHHHHHH | 12.00 | 23663014 | |
45 | N-linked_Glycosylation | EQMATNVNCSSPERH HHHHHCCCCCCCCCC | 23.25 | UniProtKB CARBOHYD | |
55 | Phosphorylation | SPERHTRSYDYMEGG CCCCCCCCCCCCCCC | 24.42 | - | |
56 | Phosphorylation | PERHTRSYDYMEGGD CCCCCCCCCCCCCCC | 14.06 | - | |
58 | Phosphorylation | RHTRSYDYMEGGDIR CCCCCCCCCCCCCEE | 6.71 | - | |
115 | Phosphorylation | VAIKGVESEFYLAMN EEEECCCEEEEEEEC | 30.51 | 28787133 | |
118 | Phosphorylation | KGVESEFYLAMNKEG ECCCEEEEEEECCCC | 6.90 | 28787133 | |
181 | Acetylation | VRGKKTKKEQKTAHF CCCCCCHHHHHCCCC | 71.28 | 30588773 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PGBM_HUMAN | HSPG2 | physical | 10702276 | |
DESI1_HUMAN | DESI1 | physical | 21988832 | |
UBQL1_HUMAN | UBQLN1 | physical | 21988832 | |
FGFR2_HUMAN | FGFR2 | physical | 11714710 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...