| UniProt ID | DESI1_HUMAN | |
|---|---|---|
| UniProt AC | Q6ICB0 | |
| Protein Name | Desumoylating isopeptidase 1 | |
| Gene Name | DESI1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 168 | |
| Subcellular Localization | Cytoplasm. Nucleus. | |
| Protein Description | Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins. Has isopeptidase but not SUMO-processing activity. Desumoylates ZBTB46 (By similarity).. | |
| Protein Sequence | MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MEPPNLYPVKLYVY -CCCCCCEEEEEEEE | 16.78 | 26074081 | |
| 10 | Ubiquitination | PPNLYPVKLYVYDLS CCCCEEEEEEEEECC | 29.60 | 23000965 | |
| 10 | Sumoylation | PPNLYPVKLYVYDLS CCCCEEEEEEEEECC | 29.60 | - | |
| 12 | Phosphorylation | NLYPVKLYVYDLSKG CCEEEEEEEEECCHH | 7.40 | 29496907 | |
| 18 | Ubiquitination | LYVYDLSKGLARRLS EEEEECCHHHHHHCC | 66.30 | 23000965 | |
| 25 | Phosphorylation | KGLARRLSPIMLGKQ HHHHHHCCHHHCCCC | 15.57 | 22617229 | |
| 31 | Ubiquitination | LSPIMLGKQLEGIWH CCHHHCCCCCCCEEE | 47.99 | 33845483 | |
| 150 | Phosphorylation | ALRPLLDSIQIQPPG HHHHHHHHCEECCCC | 19.16 | 25332170 | |
| 160 | Phosphorylation | IQPPGGSSVGRPNGQ ECCCCCCCCCCCCCC | 31.68 | 25332170 | |
| 168 | Phosphorylation | VGRPNGQS------- CCCCCCCC------- | 43.52 | 25332170 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DESI1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DESI1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DESI1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ZBT46_HUMAN | ZBTB46 | physical | 22370726 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25, AND MASSSPECTROMETRY. | |
