UniProt ID | ESCA_DROME | |
---|---|---|
UniProt AC | P25932 | |
Protein Name | Protein escargot | |
Gene Name | esg | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 470 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription factor that can both stimulate and repress transcription. Binds to the consensus DNA sequence 5'-A/GCAGGTG-3'. Regulates cell motility and adhesion during tracheal morphogenesis by stimulating transcription of the DE-cadherin gene shg at branch tips, thereby promoting tracheal tube fusion. Maintains diploidy in imaginal cells by inhibiting the transcription of genes required for endoreplication. Required for development of the genital disk and acts as an intrinsic determinant of wing cell fate. The somatic protein is required for maintenance of male germ cells. Acts with other members of the snail protein family to control embryonic central nervous system development.. | |
Protein Sequence | MHTVEDMLVEKNYSKCPLKKRPVNYQFEAPQNHSNTPNEPQDLCVKKMEILEENPSEELINVSDCCEDEGVDVDHTDDEHIEEEDEDVDVDVDSDPNQTQAAALAAAAAVAAAAAASVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLSPPPHHYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHTHHHHAPISPAYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSELNYAGYAEP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ESCA_DROME !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ESCA_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ESCA_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ESCA_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CTBP_DROME | CtBP | physical | 14605208 | |
DTX_DROME | dx | physical | 14605208 | |
BAP60_DROME | Bap60 | physical | 14605208 | |
CNN_DROME | cnn | physical | 14605208 | |
RS25_DROME | RpS25 | physical | 14605208 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...