UniProt ID | RS25_DROME | |
---|---|---|
UniProt AC | P48588 | |
Protein Name | 40S ribosomal protein S25 | |
Gene Name | RpS25 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 117 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKGDEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Acetylation | NNQVLFDKATYEKLY HCEECCCHHHHHHHH | 34.98 | 21791702 | |
56 | Acetylation | FDKATYEKLYKEVPA CCHHHHHHHHHHCCC | 46.86 | 21791702 | |
59 | Acetylation | ATYEKLYKEVPAYKL HHHHHHHHHCCCHHC | 63.77 | 21791702 | |
65 | Acetylation | YKEVPAYKLITPSVV HHHCCCHHCCCHHHH | 35.20 | 21791702 | |
97 | Acetylation | LREKGLIKQVVQHHS HHHCCHHHHHHHHHC | 41.92 | 21791702 | |
104 | Phosphorylation | KQVVQHHSQVIYTRA HHHHHHHCHHHEEEC | 24.82 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS25_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS25_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS25_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
C1GLT_DROME | C1GalTA | physical | 14605208 | |
NOTCH_DROME | N | genetic | 8297785 | |
RUNT_DROME | run | genetic | 8849891 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...