| UniProt ID | RS25_DROME | |
|---|---|---|
| UniProt AC | P48588 | |
| Protein Name | 40S ribosomal protein S25 | |
| Gene Name | RpS25 | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 117 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MPPKKDAKSSAKQPQKTQKKKEGSGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKEVPAYKLITPSVVSERLKIRGSLAKRALIELREKGLIKQVVQHHSQVIYTRATKGDEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 51 | Acetylation | NNQVLFDKATYEKLY HCEECCCHHHHHHHH | 34.98 | 21791702 | |
| 56 | Acetylation | FDKATYEKLYKEVPA CCHHHHHHHHHHCCC | 46.86 | 21791702 | |
| 59 | Acetylation | ATYEKLYKEVPAYKL HHHHHHHHHCCCHHC | 63.77 | 21791702 | |
| 65 | Acetylation | YKEVPAYKLITPSVV HHHCCCHHCCCHHHH | 35.20 | 21791702 | |
| 97 | Acetylation | LREKGLIKQVVQHHS HHHCCHHHHHHHHHC | 41.92 | 21791702 | |
| 104 | Phosphorylation | KQVVQHHSQVIYTRA HHHHHHHCHHHEEEC | 24.82 | 21082442 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS25_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS25_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS25_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| C1GLT_DROME | C1GalTA | physical | 14605208 | |
| NOTCH_DROME | N | genetic | 8297785 | |
| RUNT_DROME | run | genetic | 8849891 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...