dbPTM

ENY2B_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ENY2B_DROME
UniProt AC	Q9VI60
Protein Name	Enhancer of yellow 2b transcription factor
Gene Name	e(y)2b
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	95
Subcellular Localization
Protein Description	Testis-specific paralog of the ubiquitously expressed transcription and mRNA export factor e(y)2. Cannot functionally replace e(y)2..
Protein Sequence	MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ENY2B_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ENY2B_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ENY2B_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ENY2B_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF12_DROME	Taf12	physical	14605208
RS8_DROME	RpS8	physical	14605208
PABP_DROME	pAbp	physical	14605208

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ENY2B_DROME

Related Literatures of Post-Translational Modification