ELF5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELF5_HUMAN
• UniProt AC: Q9UKW6
• Protein Name: ETS-related transcription factor Elf-5
• Gene Name: ELF5
• Organism: Homo sapiens (Human).
• Sequence Length: 265
• Subcellular Localization: Nucleus .
• Protein Description: Transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation.; Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequence GGA[AT]. Transcriptionally activates SPRR2A and the parotid gland-specific PSP promoters..
• Protein Sequence: MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
169	Phosphorylation	CHSHSRTSLQSSHLW CCCCCCCCCCHHHHH	24.25	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELF5_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELF5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELF5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIR6_HUMAN	SIRT6	physical	16189514
RS15A_HUMAN	RPS15A	physical	16189514
NFE2_HUMAN	NFE2	physical	20211142
CREST_HUMAN	SS18L1	physical	20211142
NRIP2_HUMAN	NRIP2	physical	21988832

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.