EIF3H_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EIF3H_ARATH
• UniProt AC: Q9C5Z2
• Protein Name: Eukaryotic translation initiation factor 3 subunit H {ECO:0000255|HAMAP-Rule:MF_03007}
• Gene Name: TIF3H1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 337
• Subcellular Localization: Cytoplasm .
• Protein Description: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation (Potential). Regulates translation initiation of specific 5' mRNAs harboring multiple upstream open reading frames (uORFs) in their 5' leader sequence (e.g. BETA-OHASE 2 and LHY). [PubMed: 15548739]
• Protein Sequence: MATMARSFLQAISKDEAVAPPLRVVQIEGLAVLKIIKHCKEFSPTLVTGQLLGLDVGSVLEVTNCFPFPVRDDDEEIEADGANYQLEMMRCLREVNVDNNTVGWYQSTVLGSYQTVELIETFMNYQENIKRCVCIIYDPSKADLGVLALKALKLSDSFMELYRGGNFTGEKLREKNFSWMDIFEEIPIKVSNSALVSAFMTELETDTPVSQGDYDRLHSSTTPFLENNMEFLIKCMDDLSMEQQKFQYYYRNLSRQQAQQQAWLQKRRTENMARKSAGEEPLPEEDPSNPIFKAIPEPSRLESFLITNQVSNFCGQINGVAGQNFSRLYLTKALHDN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MATMARSFLQAISK -CCHHHHHHHHHHCC	22.29	25561503
178	Phosphorylation	KLREKNFSWMDIFEE HHHHCCCCCHHHHHH	30.77	23524850
189	Phosphorylation	IFEEIPIKVSNSALV HHHHCCEEECCHHHH	33.97	23111157
276	Phosphorylation	TENMARKSAGEEPLP HHHHHHHHCCCCCCC	35.63	30291188

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
178	S	Phosphorylation	Kinase	ATPK1	P42818	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
178	S	Phosphorylation	In response to auxin (NAA), phosphorylated at Ser-178 by ATPK1 and binds to polysomes via TOR signaling.	23524850

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EIF3H_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CSN1_ARATH	FUS6	physical	15548739
CSN8_ARATH	COP9	physical	15548739
EIF3B_ARATH	TIF3B1	physical	15548739
CSN4_ARATH	COP8	physical	15548739
CSN5A_ARATH	CSN5A	physical	15548739

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.