UniProt ID | ECL1_SCHPO | |
---|---|---|
UniProt AC | C6Y4D3 | |
Protein Name | Extender of the chronological lifespan protein 1 | |
Gene Name | ecl1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 80 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in chronological cell aging. Extends cell viability after entry into the stationary phase probably through affecting the Pka1-dependent pathway negatively.. | |
Protein Sequence | MDLDFCTVCGATTQDGSLYCSSECHLLDFTKLDTQTTSNISVSSEYQFLVSEHLAHFHRKSMTSADFPTPRFSAYTKLHA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ECL1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ECL1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ECL1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CATA_SCHPO | ctt1 | genetic | 22212525 | |
HSR1_SCHPO | hsr1 | genetic | 22212525 | |
PRR1_SCHPO | prr1 | genetic | 22212525 | |
CATA_SCHPO | ctt1 | genetic | 24696293 | |
PYP1_SCHPO | pyp1 | genetic | 24696293 | |
ECL2_SCHPO | ecl2 | genetic | 25204792 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...