ECL2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ECL2_SCHPO
• UniProt AC: C6Y4C5
• Protein Name: Extender of the chronological lifespan protein 2
• Gene Name: ecl2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 84
• Subcellular Localization: Nucleus .
• Protein Description: Involved in chronological cell aging..
• Protein Sequence: MDLDYCIICGKPTTGNLYCSRECHLQDCPGCGSTSEQCSYSKSADLHMLSSQYLDHFRRRSSMPSPSTSSSLLNGFVASRLAVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	EQCSYSKSADLHMLS CCCCCCHHHCHHHHH	22.52	29996109
61	Phosphorylation	LDHFRRRSSMPSPST HHHHHHHHCCCCCCC	29.22	25720772
62	Phosphorylation	DHFRRRSSMPSPSTS HHHHHHHCCCCCCCC	32.66	25720772
67	Phosphorylation	RSSMPSPSTSSSLLN HHCCCCCCCCHHHHH	45.30	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ECL2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ECL2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ECL2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CATA_SCHPO	ctt1	genetic	22212525
HSR1_SCHPO	hsr1	genetic	22212525
PRR1_SCHPO	prr1	genetic	22212525
ECL3_SCHPO	ecl3	genetic	25204792

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.