dbPTM

ECL3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ECL3_SCHPO
UniProt AC	C6Y4C3
Protein Name	Extender of the chronological lifespan protein ecl3
Gene Name	ecl3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	89
Subcellular Localization	Nucleus.
Protein Description	Involved in chronological cell aging..
Protein Sequence	MDLNLCLLCGNSIDAEGLYCSNECRIQDKATTELFSDPLKSPSLNETIDYLALNYFDLFSRRSSMCSSSNSSIYSGIYYTELKNYSVEN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ECL3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ECL3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ECL3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ECL3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CATA_SCHPO	ctt1	genetic	22212525
HSR1_SCHPO	hsr1	genetic	22212525
PRR1_SCHPO	prr1	genetic	22212525
ECL1_SCHPO	ecl1	genetic	25204792

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ECL3_SCHPO

Related Literatures of Post-Translational Modification