DRB5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DRB5_ARATH
• UniProt AC: Q8GY79
• Protein Name: Double-stranded RNA-binding protein 5
• Gene Name: DRB5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 393
• Protein Description: Binds double-stranded RNA. May be involved in RNA-mediated silencing..
• Protein Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of DRB5_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DRB5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DRB5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DRB5_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DCL1_ARATH	DCL1	physical	15821876
DRB5_ARATH	DRB5	physical	15821876
DRB2_ARATH	DRB2	physical	15821876
DRB4_ARATH	DRB4	physical	15821876
DRB1_ARATH	HYL1	physical	15821876
DCL3_ARATH	DCL3	physical	15821876

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.