DRB4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DRB4_ARATH
• UniProt AC: Q8H1D4
• Protein Name: Double-stranded RNA-binding protein 4
• Gene Name: DBR4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 355
• Subcellular Localization: Nucleus .
• Protein Description: Double-stranded RNA-binding protein involved in RNA-mediated post-transcriptional gene silencing (PTGS). Functions in the trans-acting small interfering RNAs (ta-siRNAs) biogenesis by binding and assisting DICER-LIKE 4 (DCL4). Required for DCL4 activity. Required for the 21 nucleotide ta-siRNAs production of the TAS3 transcript in leaves but not in flowers. Plays an important role in silencing RNA of both DNA and RNA viruses. Involved with argonaute 7 (AGO7) and RDR6 in turnip crinkle virus (TCV) silencing. May not be directly involved in viral siRNA production. May stabilize the 21 nucleotide viral siRNAs and deliver them to the RISC complex. Targeted by the viral silencing suppressor (VSR) transactivator/viroplasmin (TAV) protein of the cauliflower mosaic virus (CaMV) that inactivates DRB4 function in RNA silencing. Probably not involved in the guide strand selection from RNA duplexes. Involved in leaf morphology through its function in ta-siRNA-mediated silencing..
• Protein Sequence: MDHVYKGQLQAYALQHNLELPVYANEREGPPHAPRFRCNVTFCGQTFQSSEFFPTLKSAEHAAAKIAVASLTPQSPEGIDVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAEMSAAKVAFMSIKNGNSNQTGSPTLPSERQEDVNSNVKSSPQEIHSQPSSKVVMTPDTPSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGTLSALTTDGMKMNIASSSLPIPHNPTNVITLNAPAANGIKRNIAACSSWMPQNPTNDGSETSSCVVDESEKKKLIMGTGHLSIPTGQHVVCRPWNPEITLPQDAEMLFRDDKFIAYRLVKP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
70	Phosphorylation	AAKIAVASLTPQSPE HHHHHHHHCCCCCCC	26.61	23776212
72	Phosphorylation	KIAVASLTPQSPEGI HHHHHHCCCCCCCCH	19.45	23776212
75	Phosphorylation	VASLTPQSPEGIDVA HHHCCCCCCCCHHHH	26.56	30291188
83	Phosphorylation	PEGIDVAYKNLLQEI CCCHHHHHHHHHHHH	10.56	23776212
153	Phosphorylation	MSIKNGNSNQTGSPT EECCCCCCCCCCCCC	31.54	23776212
156	Phosphorylation	KNGNSNQTGSPTLPS CCCCCCCCCCCCCCH	43.83	23776212
158	Phosphorylation	GNSNQTGSPTLPSER CCCCCCCCCCCCHHH	20.35	30291188
160	Phosphorylation	SNQTGSPTLPSERQE CCCCCCCCCCHHHHH	53.66	23776212
163	Phosphorylation	TGSPTLPSERQEDVN CCCCCCCHHHHHHHH	48.82	23776212
171	Phosphorylation	ERQEDVNSNVKSSPQ HHHHHHHHCCCCCHH	42.73	23776212
175	Phosphorylation	DVNSNVKSSPQEIHS HHHHCCCCCHHHHHC	42.86	23776212
176	Phosphorylation	VNSNVKSSPQEIHSQ HHHCCCCCHHHHHCC	25.53	23776212
182	Phosphorylation	SSPQEIHSQPSSKVV CCHHHHHCCCCCCEE	49.82	23776212
185	Phosphorylation	QEIHSQPSSKVVMTP HHHHCCCCCCEEECC	34.84	23776212
186	Phosphorylation	EIHSQPSSKVVMTPD HHHCCCCCCEEECCC	35.83	23776212
191	Phosphorylation	PSSKVVMTPDTPSKG CCCCEEECCCCCCCC	13.35	30407730
194	Phosphorylation	KVVMTPDTPSKGIKV CEEECCCCCCCCCCC	30.57	19880383
196	Phosphorylation	VMTPDTPSKGIKVNE EECCCCCCCCCCCCC	45.68	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DRB4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DRB4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DRB4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DCL4_ARATH	DCL4	physical	17221360
DCL4_ARATH	DCL4	physical	15821876
DCL4_ARATH	DCL4	physical	20106953
DCL4_ARATH	DCL4	physical	21270136
DRB4_ARATH	DRB4	physical	21798944
APC10_ARATH	APC10	physical	22545099

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.